powered by:
Protein Alignment rho-5 and RHBDL1
DIOPT Version :9
Sequence 1: | NP_995679.1 |
Gene: | rho-5 / 2768944 |
FlyBaseID: | FBgn0041723 |
Length: | 1429 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_024306253.1 |
Gene: | RHBDL1 / 9028 |
HGNCID: | 10007 |
Length: | 526 |
Species: | Homo sapiens |
Alignment Length: | 69 |
Identity: | 20/69 - (28%) |
Similarity: | 33/69 - (47%) |
Gaps: | 6/69 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 1094 YRLLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVPH-RPEV 1157
:|.||.:.||.|:..|....:.|.:....||.:.|.:|.:::|:....||...: | ||..
Human 246 WRFLTYMFMHVGLEQLGFNALLQLMIGVPLEMVHGLLRISLLYLAGVLAGEAGA-----HPRPLP 305
Fly 1158 GPSA 1161
.|:|
Human 306 WPAA 309
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165144488 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0705 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.740 |
|
Return to query results.
Submit another query.