DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and PCP1

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_011615.1 Gene:PCP1 / 852993 SGDID:S000003333 Length:346 Species:Saccharomyces cerevisiae


Alignment Length:156 Identity:37/156 - (23%)
Similarity:61/156 - (39%) Gaps:33/156 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1096 LLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTS------AILVPHR 1154
            ::.|...|....||.:.::....|...|..::|......:|:.|..||:|.|      |.|....
Yeast   186 IIGSAFSHQEFWHLGMNMLALWSFGTSLATMLGASNFFSLYMNSAIAGSLFSLWYPKLARLAIVG 250

  Fly  1155 PEVGPSASLSGVVASLIALLVWMHWKYLHKPH--IALFK--------LLLLCSV-------LVGI 1202
            |.:|.|.:|.||:..         :.||. ||  |.||.        :..|.||       .:..
Yeast   251 PSLGASGALFGVLGC---------FSYLF-PHAKILLFVFPVPGGAWVAFLASVAWNAAGCALRW 305

  Fly  1203 GTLPYQLNFLGLLAGVICGCLLTMSL 1228
            |:..|..:..|.:.||:.|..::.::
Yeast   306 GSFDYAAHLGGSMMGVLYGWYISKAV 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 37/151 (25%)
PCP1NP_011615.1 Rhomboid 186..329 CDD:396315 37/152 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.