DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and KOM

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_001321009.1 Gene:KOM / 844122 AraportID:AT1G77860 Length:385 Species:Arabidopsis thaliana


Alignment Length:189 Identity:50/189 - (26%)
Similarity:90/189 - (47%) Gaps:37/189 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1069 CSQIS---CLNNVCGMFPFISV-ETP-----------------------DQLYRLLTSLCMHAGI 1106
            ||..|   |...:.|.|.|.|: |.|                       .:::|:|||..:|:|:
plant    71 CSGNSHGHCSAKLLGRFSFQSLSENPMLGPSASTLEHMGGLSWKALTENHEIWRILTSPWLHSGL 135

  Fly  1107 LHLAI---TLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVPHRPEVGPSASLSGVVA 1168
            .||.|   :|||..::   :|:..|.:|.|::|.:||..|:|.:.:.|.:.|.:...|:..|::.
plant   136 FHLFINLGSLIFVGIY---MEQQFGPLRIAVIYFLSGIMGSLFAVLFVRNIPSISSGAAFFGLIG 197

  Fly  1169 SLIALLVWMHWKYLHKPHIALFKLLLLCSVLVGIGTLPYQLNFL---GLLAGVICGCLL 1224
            ::::.|. .:|...:....||..:..:.:|...||.||:..||.   |.::|.:.|.:|
plant   198 AMLSALA-KNWNLYNSKISALAIIFTIFTVNFLIGFLPFIDNFANIGGFISGFLLGFVL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 41/164 (25%)
KOMNP_001321009.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3549
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.