DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and RBL2

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_176500.1 Gene:RBL2 / 842616 AraportID:AT1G63120 Length:317 Species:Arabidopsis thaliana


Alignment Length:207 Identity:56/207 - (27%)
Similarity:102/207 - (49%) Gaps:31/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1092 QLYRLLTSLCMHAGILHLAITLIFQHLFLA-DLERLIGTVRTAIVYIMSGFAGNLTSAILVPHRP 1155
            |.:|||:.:.:||||:|| :|.:...:|:. .||:..|.:|..::|::||..|::.|::.:....
plant   109 QGWRLLSCMWLHAGIIHL-LTNMLSLIFIGIRLEQQFGFIRVGLIYLISGLGGSILSSLFLQESI 172

  Fly  1156 EVGPSASLSGVVASLIALLVWMHWKYLHKPHIALFKLLLLCSVLVGIGTLPYQLNFL---GLLAG 1217
            .||.|.:|.|::.::::.|: .:|........||..||.:.::.:.:|.||...||.   |.|.|
plant   173 SVGASGALFGLLGAMLSELL-TNWTIYANKAAALITLLFIIAINLALGMLPRVDNFAHIGGFLTG 236

  Fly  1218 VICGCLLTMSLVPFTTFSKYG---------RKKKINLIWTCVLFHVVVYTAMIVTFYIHPSEFHS 1273
            ...|.:|.:.       .:||         |.|:...::..||| ||....::|..        :
plant   237 FCLGFVLLVR-------PQYGWEASRTNTSRTKRKYSMYQYVLF-VVSVVLLVVGL--------T 285

  Fly  1274 ISFVDMFSNSNG 1285
            ::.|.:|...||
plant   286 VALVMLFKGENG 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 41/136 (30%)
RBL2NP_176500.1 Rhomboid 105..244 CDD:279958 41/136 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3549
orthoMCL 1 0.900 - - OOG6_100562
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.