DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and RBL5

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_175667.1 Gene:RBL5 / 841690 AraportID:AT1G52580 Length:309 Species:Arabidopsis thaliana


Alignment Length:138 Identity:40/138 - (28%)
Similarity:70/138 - (50%) Gaps:6/138 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly  1094 YRLLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAIL--VPHRPE 1156
            :||::.:.:|.|.|||...:|........||:..|.:|...:|::||..|:|.|.:.  ...|..
plant   107 WRLISCIWLHGGFLHLMANMISLMCIGMRLEQEFGFMRIGALYVISGLGGSLVSCLTDSQGERVS 171

  Fly  1157 VGPSASLSGVVASLIALLVWMHWKYLHKPHIALFKLLLLCSVLVGIGTLP---YQLNFLGLLAGV 1218
            ||.|.:|.|::.::::.|: .:|........||..|:|:..:.:.:|.||   ...:|.|.|||.
plant   172 VGASGALFGLLGAMLSELI-TNWTIYENKCTALMTLILIIVLNLSVGFLPRVDNSAHFGGFLAGF 235

  Fly  1219 ICGCLLTM 1226
            ..|.:|.:
plant   236 FLGFVLLL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 39/135 (29%)
RBL5NP_175667.1 Rhomboid 104..246 CDD:366759 40/138 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3549
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.