DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and RBL10

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_173900.2 Gene:RBL10 / 839113 AraportID:AT1G25290 Length:343 Species:Arabidopsis thaliana


Alignment Length:168 Identity:43/168 - (25%)
Similarity:75/168 - (44%) Gaps:30/168 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1092 QLYRLLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVP---- 1152
            ||:||.|:..:||..:||.|.....:......|.|.|..|...||        ||||:..|    
plant   166 QLWRLATASVLHANPMHLMINCYSLNSIGPTAESLGGPKRFLAVY--------LTSAVAKPILRV 222

  Fly  1153 ----------HRPEVGPSASLSGVVASLIALLVWMHWKYLHKPHIALFKLLLLCSVLVGIGTLPY 1207
                      ..|.||.|.::.|:|.| :|:.|..|.:.:...:..|.::..:.::.:.:|.:..
plant   223 LGSAMSYWFNKAPSVGASGAIFGLVGS-VAVFVIRHKQMVRGGNEDLMQIAQIIALNMAMGLMSR 286

  Fly  1208 QLNFLGLLAGVICGCLLTMSLVP-----FTTFSKYGRK 1240
            :::..|.:.|::.|..:|..|.|     :||  :.||:
plant   287 RIDNWGHIGGLLGGTAMTWLLGPQWKYEYTT--RDGRR 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 36/146 (25%)
RBL10NP_173900.2 Rhomboid 161..309 CDD:279958 38/151 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100562
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.