DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and RBL6

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_001184975.1 Gene:RBL6 / 837831 AraportID:AT1G12750 Length:307 Species:Arabidopsis thaliana


Alignment Length:260 Identity:74/260 - (28%)
Similarity:123/260 - (47%) Gaps:35/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1041 TGLYGEC--RITTREYCDFIKGYFHEEASLCSQISCLNNVCGMFPFISVETPDQLYRLLTSLCMH 1103
            ||..|:|  ::..|    |......|...|....|.|..: |...:..|...::.:||:|::.:|
plant    48 TGANGDCVAKLLRR----FSFQPLRENPFLGPSSSTLEKL-GALDWKKVVQGNEKWRLITAMWLH 107

  Fly  1104 AGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVPHRPEVGPSASLSGVVA 1168
            |||:||.:.:....:|...||:..|.:|..::|::|||.|::.||:.:.....||.|.:|.|::.
plant   108 AGIIHLVMNMFDVIIFGIRLEQQFGFIRIGLIYLISGFGGSILSALFLQKSISVGASGALLGLMG 172

  Fly  1169 SLIALLVWMHWKYLHKPHIALFKLLLLCSVLVGIGTLPYQLNFL---GLLAGVICGCLLTMSLVP 1230
            ::::.|: .:|........||...|.:.::.:.||.||:..||.   |||.|...|.:|.|.  |
plant   173 AMLSELL-TNWTIYKSKLCALLSFLFIIAINLAIGLLPWVDNFAHIGGLLTGFCLGFILLMQ--P 234

  Fly  1231 ------FTTFSKYG--RKKKINLIWTC--VLFHVVVYTAMIVTFYIHPSEFHSISFVDMFSNSNG 1285
                  |...|:||  .:.|.|   .|  |||.|   .|::|...:      ::..|.:|...||
plant   235 QSGWEEFRNSSQYGARARSKYN---PCQYVLFFV---AAVLVVAGL------TVGLVMLFDGENG 287

  Fly  1286  1285
            plant   288  287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 42/137 (31%)
RBL6NP_001184975.1 Rhomboid 92..232 CDD:279958 43/140 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3549
orthoMCL 1 0.900 - - OOG6_100562
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.