DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and RBL3

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_196342.1 Gene:RBL3 / 830616 AraportID:AT5G07250 Length:346 Species:Arabidopsis thaliana


Alignment Length:207 Identity:55/207 - (26%)
Similarity:98/207 - (47%) Gaps:27/207 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1094 YRLLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVPHRPEVG 1158
            :||||.:.:|||::||...::........||:..|.||..::|::||..|::.|::.:.:...||
plant   135 WRLLTCIWLHAGVIHLGANMLSLVFIGIRLEQQFGFVRIGVIYLLSGIGGSVLSSLFIRNSISVG 199

  Fly  1159 PSASLSGVVASLIALLVWMHWKYLHKPHIALFKLLLLCSVLVGIGTLPYQLNFL---GLLAGVIC 1220
            .|.:|.|::.|:::.| :.:|........||..||.:..:.:.||.||:..||.   |.:.|.:.
plant   200 ASGALFGLLGSMLSEL-FTNWTIYSNKIAALLTLLFVILINLAIGILPHVDNFAHVGGFVTGFLL 263

  Fly  1221 GCL---------LTMSLVPFTTFSKYGRKKKINLIWTCVLFHVVVYTAMIVTFYIHPSEFHSISF 1276
            |.:         |....:|..|..:|..|....|:|   |..:|:..|..|           ::.
plant   264 GFILLARPQFKWLAREHMPQGTPLRYKYKTYQYLLW---LLSLVLLIAGFV-----------VAL 314

  Fly  1277 VDMFSNSNGYDN 1288
            :.:|...||.|:
plant   315 LMLFRGENGNDH 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 40/142 (28%)
RBL3NP_196342.1 Rhomboid 128..269 CDD:396315 40/134 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3549
orthoMCL 1 0.900 - - OOG6_100562
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X418
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.710

Return to query results.
Submit another query.