DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and RBL7

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_194038.1 Gene:RBL7 / 828406 AraportID:AT4G23070 Length:313 Species:Arabidopsis thaliana


Alignment Length:227 Identity:63/227 - (27%)
Similarity:103/227 - (45%) Gaps:47/227 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1074 CLNNVCGMFPFISVET-----PD-------------------QLYRLLTSLCMHAGILHLAITLI 1114
            ||....|.|.|.|.::     |.                   |::||||.:.:|||::||...:.
plant    61 CLAKFLGRFSFESFKSNPLLGPSSSTLEKMGALAWGKIVHKRQVWRLLTCMWLHAGVIHLLANMC 125

  Fly  1115 FQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVPHRPEVGPSASLSGVVASLIALLVWMHW 1179
            ........||:..|.||...:|::|||.|::.|.:.:.....||.|::|.|::.::::.|: ::|
plant   126 CVAYIGVRLEQQFGFVRVGTIYLVSGFCGSILSCLFLEDAISVGASSALFGLLGAMLSELL-INW 189

  Fly  1180 KYLHKPHIALFKLLLLCSVLVGIGTLPYQLNFL---GLLAGVICGCLL-----------TMSLVP 1230
            .......:|:..||::..|.:|:||||...||.   |...|.:.|.||           .:||:|
plant   190 TTYDNKGVAIVMLLVIVGVNLGLGTLPPVDNFAHIGGFFGGFLLGFLLLIHPQFEWEENQVSLMP 254

  Fly  1231 FTTFSKYGRKKKINLIWTCVLFHVVVYTAMIV 1262
            .|..     |.|.|   ||.|...:|.:.:.|
plant   255 GTIV-----KPKYN---TCQLVLCIVASIVFV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 45/167 (27%)
RBL7NP_194038.1 Rhomboid 98..224 CDD:396315 39/126 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3549
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X418
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.