DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and RBL4

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_850698.1 Gene:RBL4 / 824545 AraportID:AT3G53780 Length:394 Species:Arabidopsis thaliana


Alignment Length:413 Identity:88/413 - (21%)
Similarity:157/413 - (38%) Gaps:123/413 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   912 RDIKITEVVTKTRRHER-----------ETACCIRNDDSGCVQS-SQAECSIRGLYPTKSISTWK 964
            :|.:...:..|||..||           |::..:........|| |..|...||:   |...:|.
plant     4 KDSETAPIWGKTRERERSNNNNIQPMDLESSSSVSGQQRSLTQSRSSYEERGRGV---KEFRSWF 65

  Fly   965 KWSPSESGPGGRISGSVCGLDPKFCDAPASIAPYEWPDDITKWPICRKTNSFTQRYRYKDHTSEH 1029
            .|                 |.|  |...|::|.:.    ||.:     .|:              
plant    66 PW-----------------LIP--CFVVANVAVFV----ITMY-----VNN-------------- 88

  Fly  1030 MVCEVIGHPCCTGLYGECRITTREYCDFIKGYFH----EEASLCSQISCLNNVCGMFPFISVETP 1090
                      |....|:|      :.||: |.|.    .|..|....|......|......|...
plant    89 ----------CPKKSGDC------FADFL-GRFSFQNTRENPLLGPSSLTLQTMGGLDVKKVVKG 136

  Fly  1091 DQLYRLLTSLCMHAGILHL---AITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVP 1152
            |:.:|||:...:|.|::||   .:||:|..:   .:||..|.:|..::|::|||.|::.||:.:.
plant   137 DEGWRLLSCNWLHGGVVHLLMNMLTLLFIGI---RMEREFGFIRIGLLYLISGFGGSILSALFLR 198

  Fly  1153 HRPEVGPSASLSGVVASLIALLVWMHWKYLHKPHIALFKLLLLCSVLVGIGTLPYQLNFL---GL 1214
            ....||.|.::.|::..::: .::::|.......:.:..|:|:.:|.:|:|.||...||.   |.
plant   199 SNISVGASGAVFGLLGGMLS-EIFINWTIYSNKVVTIVTLVLIVAVNLGLGVLPGVDNFAHIGGF 262

  Fly  1215 LAGVICGCLLTMSLVPFTTFSKYG------------RKKKI--NLIWTCVLFHVVVYTAMIVTFY 1265
            ..|.:.|.:|.:.       ..||            .:.||  .::||..|.       ::|..:
plant   263 ATGFLLGFVLLIR-------PHYGWINQRNGPGAKPHRFKIYQGILWTISLL-------ILVAGF 313

  Fly  1266 IHPSEFHSISFVDMFSNSNGYDN 1288
            |       :..:.:|:|.:|.::
plant   314 I-------VGLISLFNNVDGNEH 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 39/140 (28%)
RBL4NP_850698.1 Rhomboid 133..273 CDD:396315 40/143 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3549
orthoMCL 1 0.900 - - OOG6_100562
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X418
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.