DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and RBL1

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_180469.3 Gene:RBL1 / 817453 AraportID:AT2G29050 Length:389 Species:Arabidopsis thaliana


Alignment Length:260 Identity:61/260 - (23%)
Similarity:109/260 - (41%) Gaps:67/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1074 CLNNVCGMFPFISV-ETP-----------------------DQLYRLLTSLCMHAGILHL---AI 1111
            ||....|.|.|..: |.|                       .:::||.|.:.:|||:.|:   .:
plant    86 CLARFLGRFAFQPMKENPLLGPSSLTLEKMGALDVSMVVHKHEVWRLFTCIWLHAGVFHVLANML 150

  Fly  1112 TLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVPHRPEVGPSASLSGVVASLIALLVW 1176
            :|||..:   .||:..|.||..::|::|||.|:|.|::.......||.|.:|.|::.::::.|: 
plant   151 SLIFIGI---RLEQEFGFVRIGLLYMISGFGGSLLSSLFNRAGISVGASGALFGLLGAMLSELL- 211

  Fly  1177 MHWKYLHKPHIALFKLLLLCSVLVGIGTLPYQLNFL---GLLAGVICGCLLTMSLVPFTTFSKYG 1238
            .:|........||..|:.:.::.:.:|.||:..||.   |..:|.:.|.:       |....:||
plant   212 TNWTIYANKFAALLTLIFIIAINLAVGILPHVDNFAHLGGFTSGFLLGFV-------FLIRPQYG 269

  Fly  1239 RKKKIN-------------------LIW-TCVLFHVVVYTAMIVTFY------IHPSEFHSISFV 1277
            ...:.|                   ::| |.::..:..|||.:|...      .|.|..|.:|.:
plant   270 YFNQRNNPRGYAAPSAKSKHKPYQYVLWITSLVLLIAGYTAGLVVLLRGTDLNKHCSWCHYLSCI 334

  Fly  1278  1277
            plant   335  334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 41/163 (25%)
RBL1NP_180469.3 Rhomboid 123..263 CDD:396315 40/150 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3549
orthoMCL 1 0.900 - - OOG6_100562
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X418
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.710

Return to query results.
Submit another query.