Sequence 1: | NP_995679.1 | Gene: | rho-5 / 2768944 | FlyBaseID: | FBgn0041723 | Length: | 1429 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_957498.1 | Gene: | rhbdl2 / 792002 | ZFINID: | ZDB-GENE-040426-732 | Length: | 294 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 46/197 - (23%) |
---|---|---|---|
Similarity: | 95/197 - (48%) | Gaps: | 24/197 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 1088 ETPDQLYRLLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVP 1152
Fly 1153 HRPEVGPSASLSGVVAS--LIALLVWMHWKYLHKPHIALFKLLLLCSVLVG--IGTLPY------ 1207
Fly 1208 ----QLNFLGLLAGVICGCLLTMSLVPFTTFSKYGRKKKINLIWTCVLFHVV-VYTAMIVTFYIH 1267
Fly 1268 PS 1269 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rho-5 | NP_995679.1 | Rhomboid | 1090..1225 | CDD:279958 | 33/148 (22%) |
rhbdl2 | NP_957498.1 | Rhomboid | 104..255 | CDD:279958 | 36/156 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170577610 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0705 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |