DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and rhbdl2

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_957498.1 Gene:rhbdl2 / 792002 ZFINID:ZDB-GENE-040426-732 Length:294 Species:Danio rerio


Alignment Length:197 Identity:46/197 - (23%)
Similarity:95/197 - (48%) Gaps:24/197 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1088 ETPDQLYRLLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVP 1152
            |...:.:|.::.:.:|||:.|:...|:.|.|....||.:.......:||:....||:|.|:|..|
Zfish   105 EQRKEAWRFVSYMFVHAGVEHIMGNLLMQLLLGIPLELVHKGFEVGMVYMCGVLAGSLASSIFDP 169

  Fly  1153 HRPEVGPSASLSGVVAS--LIALLVWMHWKYLHKPHIALFKLLLLCSVLVG--IGTLPY------ 1207
            ....||.|..:..::..  :.|::.:...:.|    :.:|::|::. ::||  :|...|      
Zfish   170 FSALVGASGGVYALMGGYFMNAIVNFREMRVL----LGVFRILVIV-LIVGTDVGFALYRRFIVH 229

  Fly  1208 ----QLNFLGLLAGVICGCLLTMSLVPFTTFSKYGRKKKINLIWTCVLFHVV-VYTAMIVTFYIH 1267
                :::|:..:.|.|.|  :|:..|.||.::|  ...|....|.|::.::| :..|:|...::.
Zfish   230 EAGLKVSFVAHIGGGIAG--MTIGYVFFTNYNK--ELLKDPRFWMCIVGYIVFLLFAVIFNIFLS 290

  Fly  1268 PS 1269
            |:
Zfish   291 PA 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 33/148 (22%)
rhbdl2NP_957498.1 Rhomboid 104..255 CDD:279958 36/156 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577610
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.