DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and PARL

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:XP_005247639.1 Gene:PARL / 55486 HGNCID:18253 Length:394 Species:Homo sapiens


Alignment Length:372 Identity:65/372 - (17%)
Similarity:103/372 - (27%) Gaps:153/372 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   963 WKKWSPSESGPGGRISGSVCG---------LDPK----------------FCDAPASIAPYEWPD 1002
            |:.|:....|.|.....||.|         |.|.                |..||..:.|     
Human     3 WRGWAQRGWGCGQAWGASVGGRSCEELTAVLTPPQLLGRRFNFFIQQKCGFRKAPRKVEP----- 62

  Fly  1003 DITKWPICRKTNSFTQRYRYKDHTSEHMVCEVIGHP--------------------CCTG----- 1042
                    |:::..|....||.......|.|.:.:|                    |..|     
Human    63 --------RRSDPGTSGEAYKRSALIPPVEETVFYPSPYPIRSLIKPLFFTVGFTGCAFGSAAIW 119

  Fly  1043 LYGECRITTREYCDFIK------------GYFHEEASLCSQISCLNNV------------CGMFP 1083
            .|...:...:.|.|.||            |.|.:|.:     ...||:            ..:..
Human   120 QYESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEIN-----KWWNNLSDGQRTVTGIIAANVLV 179

  Fly  1084 FISVETPD---QLYRLLTS------LC--------MHAGILHLAITLIFQHLFLADLERLIGTVR 1131
            |.....|.   .:.|..||      ||        .|..:.|:|..:.....|.:.:..::|..:
Human   180 FCLWRVPSLQRTMIRYFTSNPASKVLCSPMLLSTFSHFSLFHMAANMYVLWSFSSSIVNILGQEQ 244

  Fly  1132 TAIVYIMSGFAGNLTSAILVPHRPEVGPSASLSGVVASLIALL---------------------- 1174
            ...||:.:|...|..|.:........|||...||.:.:::|.:                      
Human   245 FMAVYLSAGVISNFVSYVGKVATGRYGPSLGASGAIMTVLAAVCTKIPEGRLAIIFLPMFTFTAG 309

  Fly  1175 -------------VWMHWKYL-HKPHI--ALFKLL------LLCSVL 1199
                         :.:.||:. |..|:  |||.::      |.|.:|
Human   310 NALKAIIAMDTAGMILGWKFFDHAAHLGGALFGMISLYTWRLACCLL 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 32/171 (19%)
PARLXP_005247639.1 Rhomboid 209..351 CDD:279958 23/141 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.