DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and rhbdl3

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:XP_005166241.1 Gene:rhbdl3 / 550128 ZFINID:ZDB-GENE-050417-2 Length:407 Species:Danio rerio


Alignment Length:184 Identity:52/184 - (28%)
Similarity:88/184 - (47%) Gaps:23/184 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1092 QLYRLLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVPHRPE 1156
            |.:|.|:.:.|||||.||.:.:..|.|....||.:.|.:|..:||:....||:|..::.....|.
Zfish   213 QAWRFLSYIFMHAGIEHLGLNMAMQLLVGVPLEMVHGALRIGLVYVCGALAGSLAVSVTDMTAPV 277

  Fly  1157 VGPSASLSGVVASLIALLVWMHWKYLHKPHIALFKL-LLLCSVLVGIGTLPY------------Q 1208
            ||.|..:..:|::.:|.:| |:|..: |....||:: :.|..:.|..|...:            .
Zfish   278 VGSSGGVYALVSAHLANVV-MNWSGM-KCQFKLFRMAMALVCMSVEFGRAVWLRCYPPAFPPCPN 340

  Fly  1209 LNFLGLLAGVICGCLLTMSLVPFTTFSKYGRKKKINLIWTCVLFHVVVYTAMIV 1262
            .:|:..|.||..|  ||:.:|....:.:  |.::.:|.|  :.|.  |||..|:
Zfish   341 PSFVAHLGGVAVG--LTLGVVVLQNYEQ--RLQEQSLFW--IFFS--VYTLFIL 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 41/145 (28%)
rhbdl3XP_005166241.1 EFh 35..95 CDD:238008
EF-hand_7 35..94 CDD:290234
Rhomboid 208..362 CDD:279958 44/152 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577611
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.