DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and parla

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_001014320.1 Gene:parla / 541485 ZFINID:ZDB-GENE-050327-8 Length:383 Species:Danio rerio


Alignment Length:116 Identity:22/116 - (18%)
Similarity:43/116 - (37%) Gaps:21/116 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1057 FIKGYFHEEASLCSQISCLNNVCGMFPFISVETPDQLYRLLTSLCMHAGILHLAITLIFQHLFLA 1121
            |:..||  .::..|:..||..|...|                   .|..::|:.:.:.....|.:
Zfish   192 FLVKYF--TSNPASKTRCLPMVLSSF-------------------SHYSVIHMVVNMYVLWTFSS 235

  Fly  1122 DLERLIGTVRTAIVYIMSGFAGNLTSAILVPHRPEVGPSASLSGVVASLIA 1172
            .:..|:|..:...:|:..|......|.:.......:|||...||.:.:::|
Zfish   236 SIVSLLGREQFLALYLSGGVISTFVSYVFKTATGRLGPSLGASGSIMTVLA 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 14/83 (17%)
parlaNP_001014320.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..75
Rhomboid 210..347 CDD:279958 16/96 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.