DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and ru

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_524790.1 Gene:ru / 44856 FlyBaseID:FBgn0003295 Length:341 Species:Drosophila melanogaster


Alignment Length:162 Identity:44/162 - (27%)
Similarity:77/162 - (47%) Gaps:23/162 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1087 VETPD---QLYRLLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSA 1148
            |..||   ||:|.|:...:||..|||...::.|.||...||.:.|::||.::|:....||:|.::
  Fly   126 VYRPDQRLQLWRFLSYALLHASWLHLGYNVLTQLLFGVPLELVHGSLRTGVIYMAGVLAGSLGTS 190

  Fly  1149 ILVPHRPEVGPSASLSGVVASLIALLVWMHWKYLHKPHIALFKLLLLCSVLVGIG---------- 1203
            ::......||.|..:..::|:.:|.|: :::..:....|.|..::|.  |...:|          
  Fly   191 VVDSEVFLVGASGGVYALLAAQLASLL-LNFGQMRHGVIQLMAVILF--VFCDLGYALYSRELAM 252

  Fly  1204 -------TLPYQLNFLGLLAGVICGCLLTMSL 1228
                   ::.|..:..|.|||:..|.||...|
  Fly   253 HQLQTRPSVSYIAHMTGALAGISVGLLLLRQL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 41/154 (27%)
ruNP_524790.1 Rhomboid 129..282 CDD:279958 42/155 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444953
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3549
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X418
65.740

Return to query results.
Submit another query.