DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and stet

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster


Alignment Length:258 Identity:67/258 - (25%)
Similarity:98/258 - (37%) Gaps:73/258 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1080 GMFPFISVET------------------PD---QLYRLLTSLCMHAGILHLAITLIFQHLFLADL 1123
            |.|.:.||.|                  ||   :::|.|..:.:|||.|||...:..|.:|...|
  Fly   234 GFFVYHSVVTGEAAPRGPIPSDSMFIYRPDKRHEIWRFLFYMVLHAGWLHLGFNVAVQLVFGLPL 298

  Fly  1124 ERLIGTVRTAIVYIMSGFAGNLTSAILVPHRPEVGPSASLSGVVASLIALLVWMHWKYLHKPHIA 1188
            |.:.|:.|.|.:|.....||:|.::|..|....||.|   .||.|.|.|.|..:...| |:....
  Fly   299 EMVHGSTRIACIYFSGVLAGSLGTSIFDPDVFLVGAS---GGVYALLAAHLANVLLNY-HQMRYG 359

  Fly  1189 LFKLL-LLCSVLVGIGTLPY--------------------------QLNFLGLLAGVICGCLLTM 1226
            :.||| :|..|....|...|                          .::::..|||.|.|  ||:
  Fly   360 VIKLLHILVFVSFDFGFAIYARYAGDELQLGSSSEFLAIDQAETAGAVSYVAHLAGAIAG--LTI 422

  Fly  1227 SLVPFTTFSKYGRKKKINLIWTCVLFHVVVYTAMIVTFYIHPSEFHSISFVDMFSNSNGYDNF 1289
            .|:...:|.   :|....|:|...|   ..|.|::|             |...|:..||:..|
  Fly   423 GLLVLKSFE---QKLHEQLLWWIAL---GTYLALVV-------------FAIAFNIMNGFAMF 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 46/164 (28%)
stetNP_788450.1 EFh <75..115 CDD:298682
EF-hand_7 91..156 CDD:290234
Rhomboid 262..428 CDD:279958 49/171 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444954
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3549
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.