DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and stet

DIOPT Version :10

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_788450.1 Gene:stet / 38169 FlyBaseID:FBgn0020248 Length:485 Species:Drosophila melanogaster


Alignment Length:258 Identity:67/258 - (25%)
Similarity:98/258 - (37%) Gaps:73/258 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1080 GMFPFISVET------------------PD---QLYRLLTSLCMHAGILHLAITLIFQHLFLADL 1123
            |.|.:.||.|                  ||   :::|.|..:.:|||.|||...:..|.:|...|
  Fly   234 GFFVYHSVVTGEAAPRGPIPSDSMFIYRPDKRHEIWRFLFYMVLHAGWLHLGFNVAVQLVFGLPL 298

  Fly  1124 ERLIGTVRTAIVYIMSGFAGNLTSAILVPHRPEVGPSASLSGVVASLIALLVWMHWKYLHKPHIA 1188
            |.:.|:.|.|.:|.....||:|.::|..|....||.|   .||.|.|.|.|..:...| |:....
  Fly   299 EMVHGSTRIACIYFSGVLAGSLGTSIFDPDVFLVGAS---GGVYALLAAHLANVLLNY-HQMRYG 359

  Fly  1189 LFKLL-LLCSVLVGIGTLPY--------------------------QLNFLGLLAGVICGCLLTM 1226
            :.||| :|..|....|...|                          .::::..|||.|.|  ||:
  Fly   360 VIKLLHILVFVSFDFGFAIYARYAGDELQLGSSSEFLAIDQAETAGAVSYVAHLAGAIAG--LTI 422

  Fly  1227 SLVPFTTFSKYGRKKKINLIWTCVLFHVVVYTAMIVTFYIHPSEFHSISFVDMFSNSNGYDNF 1289
            .|:...:|.   :|....|:|...|   ..|.|::|             |...|:..||:..|
  Fly   423 GLLVLKSFE---QKLHEQLLWWIAL---GTYLALVV-------------FAIAFNIMNGFAMF 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:426384 46/164 (28%)
stetNP_788450.1 EF-hand_7 87..157 CDD:463900
Rhomboid 262..428 CDD:426384 49/171 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.