DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and Parl

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_001005767.1 Gene:Parl / 381038 MGIID:1277152 Length:377 Species:Mus musculus


Alignment Length:77 Identity:18/77 - (23%)
Similarity:34/77 - (44%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly  1096 LLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVPHRPEVGPS 1160
            :|.|...|..:.|:|..:.....|.:.:..::|..:...||:.:|...|..|.:........|||
Mouse   207 MLLSTFSHFSLFHMAANMYVLWSFSSSIVNILGQEQFVAVYLSAGVISNFVSYVCKVATGRYGPS 271

  Fly  1161 ASLSGVVASLIA 1172
            ...||.:.:::|
Mouse   272 LGASGAIMTVLA 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 18/77 (23%)
ParlNP_001005767.1 Rhomboid 207..348 CDD:279958 18/77 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.