powered by:
Protein Alignment rho-5 and Parl
DIOPT Version :9
Sequence 1: | NP_995679.1 |
Gene: | rho-5 / 2768944 |
FlyBaseID: | FBgn0041723 |
Length: | 1429 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001005767.1 |
Gene: | Parl / 381038 |
MGIID: | 1277152 |
Length: | 377 |
Species: | Mus musculus |
Alignment Length: | 77 |
Identity: | 18/77 - (23%) |
Similarity: | 34/77 - (44%) |
Gaps: | 0/77 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1096 LLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVPHRPEVGPS 1160
:|.|...|..:.|:|..:.....|.:.:..::|..:...||:.:|...|..|.:........|||
Mouse 207 MLLSTFSHFSLFHMAANMYVLWSFSSSIVNILGQEQFVAVYLSAGVISNFVSYVCKVATGRYGPS 271
Fly 1161 ASLSGVVASLIA 1172
...||.:.:::|
Mouse 272 LGASGAIMTVLA 283
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0705 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.