DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and rho-6

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_788038.1 Gene:rho-6 / 34640 FlyBaseID:FBgn0032415 Length:263 Species:Drosophila melanogaster


Alignment Length:198 Identity:55/198 - (27%)
Similarity:85/198 - (42%) Gaps:46/198 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1057 FIKGYFHEEASLCSQISCLNNVCGMFPFISVETPDQLYRLLTSLCMHAGILHLAITLIFQHLFLA 1121
            |::...|..||     .|:..|....|..:||    .:||||.:.:|:...||::.:.||.....
  Fly    80 FVQISLHWIAS-----ECMQKVLIFKPEWNVE----YWRLLTYMLLHSDYWHLSLNICFQCFIGI 135

  Fly  1122 DLERLIGTVRTAIVYIMSGFAGNLTSAILVPHRPEVGPSASLSGVVASLIALLVWMHWKYLHKPH 1186
            .||...|..|.|:||::.|.||:|.:|.|.||...:|.||.:..::.|             |.||
  Fly   136 CLEVEQGHWRLAVVYMVGGVAGSLANAWLQPHLHLMGASAGVYAMLGS-------------HVPH 187

  Fly  1187 IAL-FKLL---------LLCSVLVGIGTLPY--------------QLNFLGLLAGVICGCLLTMS 1227
            :.| |..|         ||..:|..:|...|              :.:..|.:||::||.::...
  Fly   188 LVLNFSQLSHRFARIASLLILLLSDVGFTTYHFCHNHNRNPRTSLEAHIGGGVAGILCGFIVYRR 252

  Fly  1228 LVP 1230
            |.|
  Fly   253 LQP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 44/158 (28%)
rho-6NP_788038.1 Rhomboid 106..251 CDD:279958 45/161 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444955
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5508
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3549
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.690

Return to query results.
Submit another query.