DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and rpn1

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_922916.1 Gene:rpn1 / 325561 ZFINID:ZDB-GENE-030131-4286 Length:598 Species:Danio rerio


Alignment Length:177 Identity:41/177 - (23%)
Similarity:56/177 - (31%) Gaps:57/177 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 SPAPSTSMSMVFSAASSCSPIMTATSSARSGNHRGDDSDSVIV------VPPGGGAMAQIEAENP 380
            ||.|:.|.:.....||.     |..|..:.||  ...||..|.      :||....:.:|..||.
Zfish   155 SPYPTRSQTTRVRLASK-----TVESYTKLGN--PTKSDETIEYGPFKDIPPFSQDVMKIHYENN 212

  Fly   381 SGTCLHCNTVRRTTGV---------------HQTTQTTGPISPVPISLPVPMAMPVMSGLNEQMP 430
            | ..|..:::.||..|               |......||                .|..:.|..
Zfish   213 S-PFLTISSITRTIEVSHWGNIAVEETIDLRHTGAHLKGP----------------FSRYDYQRQ 260

  Fly   431 SQSLESSMVSVQAKRLEGGGNMAVPPGSNQHQLYRSQMA--SNPRLQ 475
            |.|..||:.|.:          .:.|.|.|...||.::.  |...||
Zfish   261 SDSGISSVKSFK----------TILPASAQDVYYRDEIGNISTSHLQ 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958
rpn1NP_922916.1 Ribophorin_I 27..448 CDD:282456 41/177 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2291
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.