DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and rho-4

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_525084.1 Gene:rho-4 / 32109 FlyBaseID:FBgn0030318 Length:417 Species:Drosophila melanogaster


Alignment Length:183 Identity:42/183 - (22%)
Similarity:85/183 - (46%) Gaps:20/183 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1094 YRLLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVPHRPEVG 1158
            :|.::.:.:|.||:||.:.||.|......||.:....|..:||:....||::.:::..|.....|
  Fly   233 WRFVSYMFVHVGIMHLMMNLIIQIFLGIALELVHHWWRVGLVYLAGVLAGSMGTSLTSPRIFLAG 297

  Fly  1159 PSASLSGVVASLIALLVWMHWKYLHKPHIALFKLLLLCSVLVGIGTLPY--------QLNFLGLL 1215
            .|..:..::.:.||.:: |::..:....:.|...|:.|  ...:||..|        |:.::..|
  Fly   298 ASGGVYALITAHIATII-MNYSEMEYAIVQLLAFLVFC--FTDLGTSVYRHLTDQHDQIGYVAHL 359

  Fly  1216 AGVICGCLLTMSLVPFTTFSKYGRKKKINLIWTCVLFHVVVYTAMIVT-FYIH 1267
            :|.:.|.|:.:.::......::.|     ::|...   |:||.|::.| ..||
  Fly   360 SGAVAGLLVGIGVLRNLEVRRWER-----ILWWVA---VIVYFALMTTGIIIH 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 33/138 (24%)
rho-4NP_525084.1 EFh_HEF <57..197 CDD:355006
EFh 73..134 CDD:238008
Rhomboid 226..374 CDD:396315 33/143 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I2842
eggNOG 1 0.900 - - E1_COG0705
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3549
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X418
54.810

Return to query results.
Submit another query.