DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and Rhbdl3

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_001099289.1 Gene:Rhbdl3 / 287556 RGDID:1311901 Length:404 Species:Rattus norvegicus


Alignment Length:370 Identity:81/370 - (21%)
Similarity:137/370 - (37%) Gaps:95/370 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   963 WK----KWSPSESG--PGGR----ISGSVCGLDPKFCDAPASIAPYEWPDDITKWPIC------- 1010
            ||    |:.|..:|  ..|:    :......|||...:...::|     |......||       
  Rat    39 WKVLFEKFDPGSTGYISTGKFRSLLESHSSKLDPHKKEVLLALA-----DSHADGQICYQDFVNL 98

  Fly  1011 ---RKTNSFTQ-------RYRYKDHTSE-----------HMVCEVI-----------GHPCCTGL 1043
               :::|||.|       |...|....|           |:..|.:           .:.||...
  Rat    99 MSNKRSNSFRQAILQGNRRLSSKALLEEKGLSLSQRLIRHVAYETLPREIDRKWYYDSYTCCPPP 163

  Fly  1044 YGECRITTREYCDFI-KGYFHEEASLCSQIS---CLNNVCGMFPFISVETPDQLYRLLTSLCMHA 1104
            :....||..|...|: .|...::..|  |::   .|.|.....|.:..    |.:|.:|.:.|||
  Rat   164 WFMITITLLEVALFLYNGVLLDQFVL--QVTHPRYLKNSLVYHPQLRA----QAWRYVTYIFMHA 222

  Fly  1105 GILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVPHRPEVGPSASLSGVVAS 1169
            |:..|.:.:..|.|....||.:.|..|..:||:....||:|..::.....|.||.|..:..:|::
  Rat   223 GVEQLGLNVALQLLVGVPLEMVHGATRIGLVYVAGVVAGSLAVSVADMTAPVVGSSGGVYALVSA 287

  Fly  1170 LIALLVWMHWKYLHKPHIALFKLLLLCSVLVGIG-----------------TLPYQLNFLGLLAG 1217
            .:|.:| |:|..:.    ..||||.:...|:.:.                 ..|:. :|:..|.|
  Rat   288 HLANIV-MNWSGMK----CQFKLLRMAVALICMSMEFGRAVWLRFHPSAYPPCPHP-SFVAHLGG 346

  Fly  1218 VICGCLLTMSLVPFTTFSKYGRKKKINLIWTCVLFHVVVYTAMIV 1262
            |..|  :|:.:|....:.:  |.:..:|.|    ..|.:||..::
  Rat   347 VAVG--ITLGVVVLRNYEQ--RLQDQSLWW----IFVTMYTIFVL 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 39/151 (26%)
Rhbdl3NP_001099289.1 EF-hand_7 36..100 CDD:404394 13/65 (20%)
Rhomboid 205..359 CDD:396315 42/165 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338198
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.