DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and CG33303

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_001260335.1 Gene:CG33303 / 2768916 FlyBaseID:FBgn0053303 Length:458 Species:Drosophila melanogaster


Alignment Length:202 Identity:40/202 - (19%)
Similarity:65/202 - (32%) Gaps:58/202 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1267 HPSEF--HSISFVDMFSNSNGYDNF-TNADHHGVDVVSSNTRYSQTQNSQYYYHHHSDDIIRKSV 1328
            ||.|.  :...||....|.:.|..: ||:....|.:.|||. .|.||...:       .:....:
  Fly   130 HPEEIRQNDKQFVKYTGNLHLYSKYRTNSQKTNVKLSSSNI-LSHTQVKPF-------SVSSNKI 186

  Fly  1329 T---------FTEKALVSH-------ILYPTAPRKTSAQQWQEVEYSRSF----------NHLSN 1367
            |         |:::.||.|       :...|..|......|..:....|.          ...|.
  Fly   187 TLGPYENVEAFSQEPLVIHYENSAPFVTVNTLERTLEISHWGNIAVQESIQMTHTGAKLKGSFSR 251

  Fly  1368 YSDRIKKSIGNISKLKQVFT------SPIRFSNKNNH---SNLMTELTSVHSENKQKY------- 1416
            | |..|:....::.||...|      |.:.:.:.|.:   ||:......:..|.:.::       
  Fly   252 Y-DFQKEGRSGLAALKSYKTYLPASASGVYYRDTNGNISTSNMNAVRDFIELELRPRFPLFGGWK 315

  Fly  1417 ----LGY 1419
                |||
  Fly   316 TQYTLGY 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958
CG33303NP_001260335.1 Ribophorin_I 35..444 CDD:282456 40/202 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2291
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.