DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and Rpn1

DIOPT Version :10

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_037199.2 Gene:Rpn1 / 25596 RGDID:3594 Length:606 Species:Rattus norvegicus


Alignment Length:147 Identity:25/147 - (17%)
Similarity:50/147 - (34%) Gaps:49/147 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 SPAPSTSMSMVFSAASSCSPIMT--ATSSARSGNHRGDDSDSVIVVPPGGGAMAQIEAENPSGTC 384
            :|.|.       ||:|...|::.  ...:....:|....:..|::..||||:.|:          
  Rat    17 APTPG-------SASSEAPPLVNEDVKRTVDLSSHLAKVTAEVVLAHPGGGSTAR---------- 64

  Fly   385 LHCNTVRRTTGVHQTTQTTGPISPVPISLPVPMAMPVMSGLNEQMPSQSLESSMVSVQAKRLEGG 449
                                 .|...::|. |.....::.|..|:..:..|.:.:.|:..:::|.
  Rat    65 ---------------------ASSFVLALE-PELESRLAHLGVQVKGEDEEDNNLEVRETKMKGK 107

  Fly   450 GN--------MAVPPGS 458
            ..        :|:.|||
  Rat   108 SGRFFTVKLPVALDPGS 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:426384
Rpn1NP_037199.2 Ribophorin_I 31..456 CDD:428028 19/126 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.