DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and Rhbdl3

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:XP_006533389.1 Gene:Rhbdl3 / 246104 MGIID:2179276 Length:433 Species:Mus musculus


Alignment Length:257 Identity:59/257 - (22%)
Similarity:90/257 - (35%) Gaps:70/257 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   963 WK----KWSPSESG--PGGR----ISGSVCGLDPKFCDAPASIAPYEWPDDITKWPIC------- 1010
            ||    |:.|..:|  ..|:    :......|||...:...::|     |......||       
Mouse    39 WKVLFEKFDPGSTGYISTGKFRSLLESHSSKLDPHKKEVLLALA-----DSHADGQICYQDFVNL 98

  Fly  1011 ---RKTNSFTQ-------RYRYKDHTSE-----------HMVCEVI-----------GHPCCTGL 1043
               :::|||.|       |...|....|           |:..|.:           .:.||...
Mouse    99 MSNKRSNSFRQAILQGNRRLSSKALLEEKGLSLSQRLIRHVAYETLPREIDRKWYYDSYTCCPPP 163

  Fly  1044 YGECRITTREYCDFI-KGYFHEEASLCSQIS---CLNNVCGMFPFISVETPDQLYRLLTSLCMHA 1104
            :....||..|...|: .|...::..|  |::   .|.|.....|.:..    |.:|.:|.:.|||
Mouse   164 WFMITITLLEVALFLYNGVLLDQFVL--QVTHPRYLKNSLVYHPQLRA----QAWRYVTYIFMHA 222

  Fly  1105 GILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVPHRPEVGPSASLSGV 1166
            |:..|.:.:..|.|....||.:.|..|..:||:    ||  ..|.||.|...|..:|...|:
Mouse   223 GVEQLGLNVALQLLVGVPLEMVHGATRIGLVYV----AG--VVAELVRHEVPVQAAADGCGL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 25/77 (32%)
Rhbdl3XP_006533389.1 EF-hand_7 36..100 CDD:372618 13/65 (20%)
Rhomboid 207..>260 CDD:389796 18/62 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834618
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.