DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and Rhbdl2

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_898986.2 Gene:Rhbdl2 / 230726 MGIID:3608413 Length:302 Species:Mus musculus


Alignment Length:201 Identity:43/201 - (21%)
Similarity:88/201 - (43%) Gaps:32/201 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1088 ETPDQLYRLLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVP 1152
            |..::.:|.::.:.:|||:.|:...|:.|.:....||.:...:|..:||:....||:|.|:|..|
Mouse   114 EKREEAWRFISYMLVHAGVQHIVGNLLMQIVLGIPLEMVHKGLRVGLVYLAGVLAGSLASSIFDP 178

  Fly  1153 HRPEVGPSASLSGVVASLIALLVWMHWKYLHKPHIALFKLLLLCSVLVG-IGTLPYQ-------- 1208
            .:..||.|..:..::......::....:.:  |...:.:||::..::.. :|...|:        
Mouse   179 LKSLVGASGGVYALMGGYFMNVIVNFREMI--PAFGIVRLLVIILIVASDMGFALYRRFFVPANG 241

  Fly  1209 --LNFLGLLAGVICGCLLTMSLVPFTTFSKYGRK-KKINLIW-------TCVLFHVVVYTAMIVT 1263
              ::|...:||...|    || :.:|.||.:.:. .|....|       .|:||      |:...
Mouse   242 SPVSFAAHIAGGFAG----MS-IGYTVFSCFDKTLLKDPRFWIAIAAYVACLLF------AVFFN 295

  Fly  1264 FYIHPS 1269
            .::.|:
Mouse   296 IFLSPA 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 30/145 (21%)
Rhbdl2NP_898986.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
Rhomboid 115..264 CDD:366759 33/155 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834617
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.