Sequence 1: | NP_995679.1 | Gene: | rho-5 / 2768944 | FlyBaseID: | FBgn0041723 | Length: | 1429 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_898986.2 | Gene: | Rhbdl2 / 230726 | MGIID: | 3608413 | Length: | 302 | Species: | Mus musculus |
Alignment Length: | 201 | Identity: | 43/201 - (21%) |
---|---|---|---|
Similarity: | 88/201 - (43%) | Gaps: | 32/201 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 1088 ETPDQLYRLLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVP 1152
Fly 1153 HRPEVGPSASLSGVVASLIALLVWMHWKYLHKPHIALFKLLLLCSVLVG-IGTLPYQ-------- 1208
Fly 1209 --LNFLGLLAGVICGCLLTMSLVPFTTFSKYGRK-KKINLIW-------TCVLFHVVVYTAMIVT 1263
Fly 1264 FYIHPS 1269 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rho-5 | NP_995679.1 | Rhomboid | 1090..1225 | CDD:279958 | 30/145 (21%) |
Rhbdl2 | NP_898986.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..38 | ||
Rhomboid | 115..264 | CDD:366759 | 33/155 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167834617 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0705 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |