Sequence 1: | NP_995679.1 | Gene: | rho-5 / 2768944 | FlyBaseID: | FBgn0041723 | Length: | 1429 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001366679.1 | Gene: | rom-2 / 183564 | WormBaseID: | WBGene00004401 | Length: | 348 | Species: | Caenorhabditis elegans |
Alignment Length: | 200 | Identity: | 47/200 - (23%) |
---|---|---|---|
Similarity: | 78/200 - (39%) | Gaps: | 38/200 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 1092 QLYRLLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVPHRPE 1156
Fly 1157 VGPSASLSGVVASLIALLVWMHWKYLHKPHIALFKLLLLCSVLVGIGTLPY-------------- 1207
Fly 1208 QLNFLGLLAGVICGCLLTMSLVPFTTFSKYGRKKKINLIWTCVLFHVVV-----YTAMIVTFYIH 1267
Fly 1268 PSEFH 1272 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rho-5 | NP_995679.1 | Rhomboid | 1090..1225 | CDD:279958 | 34/146 (23%) |
rom-2 | NP_001366679.1 | EF-hand_7 | 21..82 | CDD:404394 | |
Rhomboid | 165..311 | CDD:396315 | 36/160 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0705 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |