DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and rom-2

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_001366679.1 Gene:rom-2 / 183564 WormBaseID:WBGene00004401 Length:348 Species:Caenorhabditis elegans


Alignment Length:200 Identity:47/200 - (23%)
Similarity:78/200 - (39%) Gaps:38/200 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1092 QLYRLLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVPHRPE 1156
            :|:||.|...::.||.|:...::.|......|| |:...|..|:|.|....|::.|..|.|....
 Worm   168 ELWRLFTYCLINVGIFHIIFNILIQLAIGVPLE-LVHRWRIYILYFMGVLFGSILSLALDPTVFL 231

  Fly  1157 VGPSASLSGVVASLIALLVWMHWKYLHKPHIALFKLLLLCSVLVGIGTLPY-------------- 1207
            .|.:|....::||.|..:. .::|.:......|       .:|:....|.|              
 Worm   232 CGGAAGSFSLIASHITTIA-TNFKEMENATCRL-------PILIVFAALDYVLAVYQRFFAPRID 288

  Fly  1208 QLNFLGLLAGVICGCLLTMSLVPFTTFSKYGRKKKINLIWTCVLFHVVV-----YTAMIVTFYIH 1267
            :::..|.|.|::.|.|.|..|.         |..|.:..:| |.|.|.:     :.|:.:|....
 Worm   289 KVSMYGHLGGLVAGILFTFILF---------RGSKPSRFYT-VSFWVSLVLSGFFIAICITLIAA 343

  Fly  1268 PSEFH 1272
            ||..|
 Worm   344 PSMLH 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 34/146 (23%)
rom-2NP_001366679.1 EF-hand_7 21..82 CDD:404394
Rhomboid 165..311 CDD:396315 36/160 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.