DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and ribo-1

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_501065.2 Gene:ribo-1 / 177456 WormBaseID:WBGene00020683 Length:586 Species:Caenorhabditis elegans


Alignment Length:291 Identity:54/291 - (18%)
Similarity:104/291 - (35%) Gaps:62/291 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1112 TLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVPHRPEVGPSASLSGVVASLIALLVW 1176
            |.:|.|:| .|:  ::..:||.::.........:.:...|..|||     .|..........||.
 Worm   336 TKLFDHVF-NDI--VVEKLRTKVLLPEHVKRVKVATPYAVDRRPE-----ELKPTYLDTTGRLVL 392

  Fly  1177 MHWKYLHKP-HIALFKLLLLCSVLVGIGTLPYQLNFLGLLAGVICGCLLTMSLVPFTTFSKYGRK 1240
            :..|....| |...|             |:.|:..|:.:|...:.......||            
 Worm   393 VLEKENIVPDHSQFF-------------TVTYEFEFVDMLREPLLASAFFFSL------------ 432

  Fly  1241 KKINLIWTCVLFHVVVYTAMIVTFYIHPS-EFHSISFVDMFSNSNGYDNFTNADHHGVDVVSSNT 1304
                      .|.::||:....|....|: :....|.:.:.:.:...|:..:|..   |::.::.
 Worm   433 ----------FFVIIVYSRFDFTISSDPAKDAEERSQIILGNLAKSVDSKQSAYE---DLIEASQ 484

  Fly  1305 RYSQTQNSQYYYHHHSDDII---RKSVTFTEKALVSHILYPTAPRKTSAQQWQE-VEYSRS-FNH 1364
            :|..|:|...........|.   :::.|.|:|...    ..|....::|::..| ::|.:: |:.
 Worm   485 QYKSTKNDADLQEAKKTFIAARNQENSTLTDKIAT----LKTDSGASAAEKASELLKYDKTVFDA 545

  Fly  1365 LSNYSDRIKKSIGNISKLKQVFTSPIRFSNK 1395
            :.||...::|     |..|...|...:|.||
 Worm   546 VDNYLKAVEK-----STTKTAGTEEQQFLNK 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 22/113 (19%)
ribo-1NP_501065.2 Ribophorin_I 23..422 CDD:282456 22/106 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2291
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.