DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and RHBDL3

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_001350764.1 Gene:RHBDL3 / 162494 HGNCID:16502 Length:428 Species:Homo sapiens


Alignment Length:90 Identity:33/90 - (36%)
Similarity:43/90 - (47%) Gaps:13/90 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1092 QLYRLLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVPHRPE 1156
            |::|.||.:.|||||.||.:.::.|.|....||.:.|..|..:||:    ||  ..|.||.|...
Human   210 QVWRYLTYIFMHAGIEHLGLNVVLQLLVGVPLEMVHGATRIGLVYV----AG--VVAELVRHEVP 268

  Fly  1157 V-------GPSASLSGVVASLIALL 1174
            |       ||.....||.|..:|.|
Human   269 VQAAADGCGPYLYEHGVWAGRVAPL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 33/90 (37%)
RHBDL3NP_001350764.1 EF-hand_7 36..100 CDD:316058
EF-hand motif 38..67 CDD:320054
Rhomboid 205..>260 CDD:328780 21/55 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144490
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.