Sequence 1: | NP_995679.1 | Gene: | rho-5 / 2768944 | FlyBaseID: | FBgn0041723 | Length: | 1429 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001254516.1 | Gene: | rhbdl1 / 100887821 | ZFINID: | ZDB-GENE-120529-2 | Length: | 396 | Species: | Danio rerio |
Alignment Length: | 259 | Identity: | 55/259 - (21%) |
---|---|---|---|
Similarity: | 102/259 - (39%) | Gaps: | 66/259 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 1061 YFHEEASLCSQISCLNNVCGMFPFISVET-----------------------PD----------- 1091
Fly 1092 ---QLYRLLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVPH 1153
Fly 1154 RPEVGPSASLSGVVASLIALLVWMHWKYLHKPHIALFKLLLLCSVLVGIG---------TLPY-- 1207
Fly 1208 -QLNFLGLLAGVICGCLLTMSLVPFTTFSKYGRKKKINLIWTCVLFHVVVYTAMIVTFYIHPSE 1270 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rho-5 | NP_995679.1 | Rhomboid | 1090..1225 | CDD:279958 | 39/160 (24%) |
rhbdl1 | NP_001254516.1 | Rhomboid | 197..351 | CDD:279958 | 39/156 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170577609 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0705 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |