DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-5 and rhbdl1

DIOPT Version :9

Sequence 1:NP_995679.1 Gene:rho-5 / 2768944 FlyBaseID:FBgn0041723 Length:1429 Species:Drosophila melanogaster
Sequence 2:NP_001254516.1 Gene:rhbdl1 / 100887821 ZFINID:ZDB-GENE-120529-2 Length:396 Species:Danio rerio


Alignment Length:259 Identity:55/259 - (21%)
Similarity:102/259 - (39%) Gaps:66/259 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1061 YFHEEASLCSQISCLNNVCGMFPFISVET-----------------------PD----------- 1091
            |||:           |.:|....|::|.|                       ||           
Zfish   145 YFHQ-----------NRLCPPPVFMAVITIVQIMVFMCYGVMLNKWVLQTYQPDFMKSPLVYHPG 198

  Fly  1092 ---QLYRLLTSLCMHAGILHLAITLIFQHLFLADLERLIGTVRTAIVYIMSGFAGNLTSAILVPH 1153
               |::|..:.:.||.|:..|....:.|.:....||.:.|.:|.:::|:....||:||.:|....
Zfish   199 HRAQIWRFFSYMFMHVGLEQLGFNALLQLMIGVPLEMVHGILRISLLYMAGVIAGSLTVSITDMR 263

  Fly  1154 RPEVGPSASLSGVVASLIALLVWMHWKYLHKPHIALFKLLLLCSVLVGIG---------TLPY-- 1207
            .|.||.|..:..:.::.:|.:| |:|..:..|:..|..:|.|..:...:|         .||.  
Zfish   264 APVVGGSGGVYALCSAHLANVV-MNWAGMKCPYKLLRMILALVCMSSEVGRAVWLRFSPPLPSSG 327

  Fly  1208 -QLNFLGLLAGVICGCLLTMSLVPFTTFSKYGRKKKINLIWTCVLFHVVVYTAMIVTFYIHPSE 1270
             |.:|:..|:|.:.|  ::|.|:...::.:...|:   ..|..::|..|.:....:.:.|...|
Zfish   328 PQPSFMAHLSGAVVG--ISMGLLILRSYEESLHKQ---CSWWVLIFSFVTFLLFAIFWNIFAYE 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-5NP_995679.1 Rhomboid 1090..1225 CDD:279958 39/160 (24%)
rhbdl1NP_001254516.1 Rhomboid 197..351 CDD:279958 39/156 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577609
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.