DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33296 and CG31904

DIOPT Version :9

Sequence 1:NP_001285711.1 Gene:CG33296 / 2768941 FlyBaseID:FBgn0053296 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster


Alignment Length:213 Identity:70/213 - (32%)
Similarity:104/213 - (48%) Gaps:54/213 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TSYASGTKPFSPDPKRGKWEKPTDYLFACFGLALKLDIF-EVSY-------WFFFNIGFVGMLPY 61
            ::|.:..:|:..|..||:|.|..|:.||....|....|| |:|.       |..|      ::.|
  Fly    69 SAYDTLERPYRHDKCRGRWAKSADFYFASCTHAFSSLIFSELSTFGILHGGWLLF------IIAY 127

  Fly    62 FLYMVIYLVPILVVHSFMGQFSSSGFIAAFRLAPLFKGMGYVSIFLTFTTLIYYSMFVAIPLLFL 126
            .:.|:.|.:||.::.:|:|||||||.|:|||:||:|||:||..:.|...||.|||:...:||::.
  Fly   128 LMGMLFYSLPIFLIQAFLGQFSSSGTISAFRVAPIFKGIGYAILLLNLGTLTYYSIAAVVPLIYT 192

  Fly   127 INSFRPTLPW-SCEGLKSWHNRTDEYPTLCHPTIYKQHENYTLGVEAPSRLYFDYIRQDYFNTDK 190
            :||..|.:|| ||.  .||:  |.|    |     ..||||                        
  Fly   193 VNSIHPVIPWMSCN--NSWN--TQE----C-----SLHENY------------------------ 220

  Fly   191 RFDISRPLIGLFTLSWAL 208
              |:...:..:|||:.|:
  Fly   221 --DVDFAVAVIFTLALAM 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33296NP_001285711.1 SLC5-6-like_sbd 27..496 CDD:271356 63/191 (33%)
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 54/159 (34%)
Cuticle_4 276..344 CDD:292577
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473195
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007612
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11616
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.