DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33282 and ARN1

DIOPT Version :9

Sequence 1:NP_001097067.1 Gene:CG33282 / 2768939 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_011823.1 Gene:ARN1 / 856345 SGDID:S000001032 Length:627 Species:Saccharomyces cerevisiae


Alignment Length:234 Identity:42/234 - (17%)
Similarity:79/234 - (33%) Gaps:76/234 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 QLAAAENSFRYYRNQRSAICEQT----SKVNFEELRTAVLSQQTRNATPLSYKDLTTKPALKGFA 266
            ||:...|:.   |..||.|.:||    |..|...|:..:|                        .
Yeast    42 QLSEKYNAL---RQNRSLIIQQTEIIGSAYNKWYLQAILL------------------------L 79

  Fly   267 ASIVLSLGYQFSGVFSFI--NYMSDIFKASGSVVDVNTATIIIGLVQIVGVYTSTILVDIVGRRV 329
            ::.:...||...|...:|  .|.:..:.....:..:|....::.....: :|..  |.|:.||..
Yeast    80 SAFICGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQI-IYAR--LSDVFGRLY 141

  Fly   330 LMLISTMGVGIGCIAFGCFTYLAKIYDLSDFNWLPLVLMIIICYVA-----NIGLIGIFFLVLVE 389
            |.:.:.:...:|.|      ..::.||:..             |.|     |.|.:|:..::|:.
Yeast   142 LFISAVILYVVGTI------IQSQAYDVQR-------------YAAGAIFYNAGYVGVILILLII 187

  Fly   390 LFPVKIRSLATSLSVIFLSL---LVFGTLKLFPLMLHYW 425
            |..             |.||   |::..:..:|.:::.|
Yeast   188 LSD-------------FSSLKWRLLYQFVPTWPFIINTW 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33282NP_001097067.1 MFS 21..448 CDD:119392 42/234 (18%)
MFS_1 53..409 CDD:284993 37/213 (17%)
ARN1NP_011823.1 MFS_ARN_like 74..586 CDD:340880 30/199 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.