Sequence 1: | NP_001097067.1 | Gene: | CG33282 / 2768939 | FlyBaseID: | FBgn0053282 | Length: | 460 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_013591.1 | Gene: | ATR1 / 854924 | SGDID: | S000004584 | Length: | 542 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 247 | Identity: | 52/247 - (21%) |
---|---|---|---|
Similarity: | 94/247 - (38%) | Gaps: | 86/247 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 259 KPALKGFAASIVLSL--GY-QFSGVFSFINYMSDIFKASGSVVDVNTATIIIGLVQIVGVYTSTI 320
Fly 321 LVDIVGRRVLMLISTMGVGIGCI---------------AFGCFT------YLAKIYDLS------ 358
Fly 359 ----DFNWLPLVL----MIIICYVAN--------------IGLIGIFFLVLVELFPVKI------ 395
Fly 396 -RSLATSLSVIFLSL-LVFGTLKLFPLMLHYWGISFTMWFSAASALLTFFYF 445 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33282 | NP_001097067.1 | MFS | 21..448 | CDD:119392 | 52/247 (21%) |
MFS_1 | 53..409 | CDD:284993 | 40/208 (19%) | ||
ATR1 | NP_013591.1 | MFS_Amf1_MDR_like | 73..517 | CDD:341029 | 52/247 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0254 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |