DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33282 and ATR1

DIOPT Version :9

Sequence 1:NP_001097067.1 Gene:CG33282 / 2768939 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_013591.1 Gene:ATR1 / 854924 SGDID:S000004584 Length:542 Species:Saccharomyces cerevisiae


Alignment Length:247 Identity:52/247 - (21%)
Similarity:94/247 - (38%) Gaps:86/247 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 KPALKGFAASIVLSL--GY-QFSGVFSFINYMSDIFKASGSVVDVNTATIIIGLVQIVGVYTSTI 320
            |..|.|:...|:.||  |. ::||..:|. .:|..|:..|....:.....|||.:.:.|.:...|
Yeast   136 KMLLVGYVLVIIWSLICGITKYSGSDTFF-IISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNI 199

  Fly   321 LVDIVGRRVLMLISTMGVGIGCI---------------AFGCFT------YLAKIYDLS------ 358
            ::..||     .::.:|..:||:               ||..::      ::..||.:.      
Yeast   200 VISFVG-----AMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIPTN 259

  Fly   359 ----DFNWLPLVL----MIIICYVAN--------------IGLIGIFFLVLVELFPVKI------ 395
                ..:|:..||    :|::.:|.|              |.:|.:.|||:..::.::.      
Yeast   260 IHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISVIFLVVFIIYEIRFAKTPLL 324

  Fly   396 -RSLATSLSVIFLSL-LVFGTLKLFPLMLHYWGISFTMWFSAASALLTFFYF 445
             |::.....:|.:.| |.||           || ||        .:.||:||
Yeast   325 PRAVIKDRHMIQIMLALFFG-----------WG-SF--------GIFTFYYF 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33282NP_001097067.1 MFS 21..448 CDD:119392 52/247 (21%)
MFS_1 53..409 CDD:284993 40/208 (19%)
ATR1NP_013591.1 MFS_Amf1_MDR_like 73..517 CDD:341029 52/247 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.