DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33282 and AMF1

DIOPT Version :9

Sequence 1:NP_001097067.1 Gene:CG33282 / 2768939 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_015023.1 Gene:AMF1 / 854560 SGDID:S000005905 Length:515 Species:Saccharomyces cerevisiae


Alignment Length:456 Identity:89/456 - (19%)
Similarity:143/456 - (31%) Gaps:178/456 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 NLAQISWLGSMLGLDSLCGNLTIAMLIERAGR--------KFCLYLMAGPYACIWIL-----IYC 108
            |..|:||..|..       :||:...|..|||        ||  :::...:..:|.|     :| 
Yeast    78 NAGQLSWFASAY-------SLTVGTFILIAGRLGDIFGHKKF--FVLGFFWYALWSLLAGFSVY- 132

  Fly   109 ASNVYYLYAARFLCGFTGGAGYLVVPIFISEVADSNIRGALTSMVM----LSVDLGILAGYILST 169
             ||..:....|   .|.|.....::|..|:.:..:...|...:||.    .|...|...|.:.|:
Yeast   133 -SNQIFFDCCR---AFQGMGPAFLLPNAIAILGRTYKPGRRKNMVFSLFGASAPGGFFLGAVFSS 193

  Fly   170 YL--------AYHVVPFLAIILPVA-YFIANIMLPETAPYLLKKSQLAAAENSFRYYRNQRSAIC 225
            .|        ||.::.....:|.|| ||:    :|.                             
Yeast   194 MLGQLAWWPWAYWIMGIACFVLAVAGYFV----IPH----------------------------- 225

  Fly   226 EQTSKVNFEELRTAVLSQQTRNATPLSYKDLTTKPALK--GFAASIVLSLGYQFSGVFSFI--NY 286
                                   ||:..:|.::...|:  .||.|:        :||...|  |:
Yeast   226 -----------------------TPMPSRDASSFKLLERIDFAGSV--------TGVVGLILFNF 259

  Fly   287 MSDIFKASGSVVDVNTATIIIGLVQIVGVYTSTILVDIVGRRVLMLI------STMGVGIGCIAF 345
            ..:    .|.||...|......|  |||.:...|...|..|....|:      |.....:.|||.
Yeast   260 AWN----QGPVVGWQTPYTYALL--IVGTFFLVIFAYIESRAAFPLLPFAALSSDTAFVLSCIAA 318

  Fly   346 GCFTYLAKIYDLSDFNW---------LPLVLMIIICYVANIGLIGIFFLVLVELFPVKIRSLATS 401
            |..::...|:    :.|         .||                   |...:..||.|.....:
Yeast   319 GWASFGIWIF----YTWQFMEDSRGQTPL-------------------LSSAQFSPVAISGFCAA 360

  Fly   402 LSVIFL-------SLLVF-------GTLKLFPLMLH--YWGISFT----------MWFSAASALL 440
            ::..||       ::::|       ||:.:....:|  ||..:|.          |.|.||:.:|
Yeast   361 VTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIML 425

  Fly   441 T 441
            :
Yeast   426 S 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33282NP_001097067.1 MFS 21..448 CDD:119392 89/456 (20%)
MFS_1 53..409 CDD:284993 77/403 (19%)
AMF1NP_015023.1 MFS_Amf1_MDR_like 48..493 CDD:341029 89/456 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.