DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33282 and SLC2A4

DIOPT Version :9

Sequence 1:NP_001097067.1 Gene:CG33282 / 2768939 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_001033.1 Gene:SLC2A4 / 6517 HGNCID:11009 Length:509 Species:Homo sapiens


Alignment Length:501 Identity:118/501 - (23%)
Similarity:196/501 - (39%) Gaps:97/501 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QQKTRYQLLATV---IVNIITFGHGVGV--------------GWLSPTLTKIQTADSPLDFEVNL 58
            ||:....|:..|   ::..:.||:.:||              .||..     |..:.|.......
Human    17 QQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETWLGR-----QGPEGPSSIPPGT 76

  Fly    59 AQISWLGS--MLGLDSLCGNLTIAMLIERAGRKFCLY---LMAGPYACIWILIYCASNVYYLYAA 118
            ....|..|  :..:..:..:..|.::.:..|||..:.   ::|.....:..|...|::...|...
Human    77 LTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAVLGGSLMGLANAAASYEMLILG 141

  Fly   119 RFLCGFTGGAGYLVVPIFISEVADSNIRGALTSMVMLSVDLGILAGYILS------------TYL 171
            |||.|...|....:||:::.|:|.:::||||.::..|::.:|||...:|.            ..|
Human   142 RFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILIAQVLGLESLLGTASLWPLLL 206

  Fly   172 AYHVVPFL--AIILPVAYFIANIMLPETAPYLLKKSQL-AAAENSFRYYRNQRSAICEQTSKVNF 233
            ...|:|.|  .::||        ..||:..||.....| ..|..|.:     |.......|.| .
Human   207 GLTVLPALLQLVLLP--------FCPESPRYLYIIQNLEGPARKSLK-----RLTGWADVSGV-L 257

  Fly   234 EELRTAVLSQQTRNATPLSYKDLT-TKPALKGFAASIVLSLGYQFSGVFSFINYMSDIFKASGSV 297
            .||:..  .::.....|||...|. ::...:....::||.|..|.||:.:...|.:.||:.:| |
Human   258 AELKDE--KRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQLSGINAVFYYSTSIFETAG-V 319

  Fly   298 VDVNTATIIIGLVQIVGVYTSTILVDIVGRRVLMLISTMGVGIGCIAFGCFTYLAKIYDLSDFNW 362
            .....|||..|:|..|....|.:||:..|||.|.|:...|:   |   ||...:.          
Human   320 GQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGM---C---GCAILMT---------- 368

  Fly   363 LPLVL------MIIICYVANIGLIGIF--------FLVLVELFPVKIRSLATSLSVI--FLSLLV 411
            :.|:|      |..:..||..|.:..|        :.::.|||....|..|.:::..  :.|..:
Human   369 VALLLLERVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGFSNWTSNFI 433

  Fly   412 FGTLKLFPLMLHYWGISFTMWFSAASALLTFFYF-WLFLQETKGKS 456
            .|  ..|..:....|....:.|  |..||.||.| :|.:.||:|::
Human   434 IG--MGFQYVAEAMGPYVFLLF--AVLLLGFFIFTFLRVPETRGRT 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33282NP_001097067.1 MFS 21..448 CDD:119392 111/481 (23%)
MFS_1 53..409 CDD:284993 91/392 (23%)
SLC2A4NP_001033.1 Interaction with SRFBP1. /evidence=ECO:0000269|PubMed:16647043 7..13
Sugar_tr 27..483 CDD:306568 115/491 (23%)
Monosaccharide binding. /evidence=ECO:0000250|UniProtKB:P11166 298..304 3/5 (60%)
Dileucine internalization motif. /evidence=ECO:0000269|PubMed:8300557 489..490
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144118
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X26
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.