DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33282 and SLC2A2

DIOPT Version :9

Sequence 1:NP_001097067.1 Gene:CG33282 / 2768939 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_000331.1 Gene:SLC2A2 / 6514 HGNCID:11006 Length:524 Species:Homo sapiens


Alignment Length:418 Identity:112/418 - (26%)
Similarity:178/418 - (42%) Gaps:61/418 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 WLGSMLGLDSLCGNLTIAMLIERAGRKFCLYLMAGPYACIWILIYCASNVYYLYAARFLCGFTGG 127
            |||..||....   :.:|.::...|.....:...||   ..|||....::..||     ||...|
Human   117 WLGDTLGRIKA---MLVANILSLVGALLMGFSKLGP---SHILIIAGRSISGLY-----CGLISG 170

  Fly   128 AGYLVVPIFISEVADSNIRGALTSMVMLSVDLGILAG------YILSTYLAYHVVPFLAIILPVA 186
                :||::|.|:|.:.:||||.:...|::..|||..      :||..|..:|::..|:.:..:.
Human   171 ----LVPMYIGEIAPTALRGALGTFHQLAIVTGILISQIIGLEFILGNYDLWHILLGLSGVRAIL 231

  Fly   187 YFIANIMLPETAPYL-LKKSQLAAAENSFRYYRNQRSAICEQTSKVN-FEELRTAVLSQQTRNAT 249
            ..:.....||:..|| :|..:...|:.|.:..|...    :.|..:| ..:.|....|:|..:..
Human   232 QSLLLFFCPESPRYLYIKLDEEVKAKQSLKRLRGYD----DVTKDINEMRKEREEASSEQKVSII 292

  Fly   250 PLSYKDLTTKPALKGFAASIVLSLGYQFSGVFSFINYMSDIFKASGSVVDVNTATIIIGLVQIVG 314
            .|.......:|.|    .:::|.:..||||:.....|.:.||:.:|....| .|||.:|.|.:|.
Human   293 QLFTNSSYRQPIL----VALMLHVAQQFSGINGIFYYSTSIFQTAGISKPV-YATIGVGAVNMVF 352

  Fly   315 VYTSTILVDIVGRRVLMLISTMGVGIGCIAFGCFTYLA-KIYDLSDFNWLPLVLMIIICYVANIG 378
            ...|..||:..|||.|.||...|:      |.|..::: .:..|:.|:|:..|.||.|....:..
Human   353 TAVSVFLVEKAGRRSLFLIGMSGM------FVCAIFMSVGLVLLNKFSWMSYVSMIAIFLFVSFF 411

  Fly   379 LIG---IFFLVLVELFPVKIRSLATSLSVI------FLSLLVFGTLKLF--PLMLHYWGISFTMW 432
            .||   |.:.::.|.|....|..|.:::..      |:..|.|..:..|  |.          ::
Human   412 EIGPGPIPWFMVAEFFSQGPRPAALAIAAFSNWTCNFIVALCFQYIADFCGPY----------VF 466

  Fly   433 FSAASALLTFFYFWLF-LQETKGKSMIE 459
            |..|..||.|..|..| :.||||||..|
Human   467 FLFAGVLLAFTLFTFFKVPETKGKSFEE 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33282NP_001097067.1 MFS 21..448 CDD:119392 104/404 (26%)
MFS_1 53..409 CDD:284993 94/363 (26%)
SLC2A2NP_000331.1 Sugar_tr 14..499 CDD:278511 112/418 (27%)
MFS 98..485 CDD:119392 105/407 (26%)
Monosaccharide binding. /evidence=ECO:0000250|UniProtKB:P11166 314..320 4/5 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144111
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X26
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.