DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33282 and SLC2A1

DIOPT Version :9

Sequence 1:NP_001097067.1 Gene:CG33282 / 2768939 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_006507.2 Gene:SLC2A1 / 6513 HGNCID:11005 Length:492 Species:Homo sapiens


Alignment Length:462 Identity:113/462 - (24%)
Similarity:191/462 - (41%) Gaps:76/462 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TFGHGVGVGWLSPTLTKIQTADSPLDFEVNLAQISWLGSMLGLDSLCGNLTIAMLIERAGRK--- 89
            |:.|..|...|..|||.:        :.:::|..| :|.|:      |:.::.:.:.|.||:   
Human    47 TWVHRYGESILPTTLTTL--------WSLSVAIFS-VGGMI------GSFSVGLFVNRFGRRNSM 96

  Fly    90 FCLYLMAGPYACIWILIYCASNVYYLYAARFL----CGFTGGAGYLVVPIFISEVADSNIRGALT 150
            ..:.|:|...|.:........:...|...||:    ||.|.|    .||:::.||:.:.:||||.
Human    97 LMMNLLAFVSAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTG----FVPMYVGEVSPTALRGALG 157

  Fly   151 SMVMLSVDLGILAGYILS------------TYLAYHVVPFL--AIILPVAYFIANIMLPETAPYL 201
            ::..|.:.:|||...:..            ..|:...:|.|  .|:||        ..||:..:|
Human   158 TLHQLGIVVGILIAQVFGLDSIMGNKDLWPLLLSIIFIPALLQCIVLP--------FCPESPRFL 214

  Fly   202 LKKSQLAAAENSFRYYRNQRSAICEQ---TSKVNFEELRTAVLSQQTRNATPLSYKDLTTKPALK 263
            |..          |...|:..::.::   |:.|..:.......|:|......::..:|...||.:
Human   215 LIN----------RNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYR 269

  Fly   264 -GFAASIVLSLGYQFSGVFSFINYMSDIFKASGSVVDVNTATIIIGLVQIVGVYTSTILVDIVGR 327
             ....::||.|..|.||:.:...|.:.||:.:| |.....|||..|:|.......|..:|:..||
Human   270 QPILIAVVLQLSQQLSGINAVFYYSTSIFEKAG-VQQPVYATIGSGIVNTAFTVVSLFVVERAGR 333

  Fly   328 RVLMLISTMGVGIGCIAFGCFTYLAKIYDLSDFNWLPLVLMIIICYVANIGLIGIFFLVLVELFP 392
            |.|.||...|:. || |......||.:..|...::|.:|.:........:|...|.:.::.|||.
Human   334 RTLHLIGLAGMA-GC-AILMTIALALLEQLPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFS 396

  Fly   393 VKIRSLATSLSVI--FLSLLVFGTLKLFPLML--HYWGISFTMWFSAASALLTFFYFWLF-LQET 452
            ...|..|.:::..  :.|..:.|....:...|  .|..|.||:      .|:.||.|..| :.||
Human   397 QGPRPAAIAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTV------LLVLFFIFTYFKVPET 455

  Fly   453 KGKSMIE 459
            ||::..|
Human   456 KGRTFDE 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33282NP_001097067.1 MFS 21..448 CDD:119392 107/448 (24%)
MFS_1 53..409 CDD:284993 89/382 (23%)
SLC2A1NP_006507.2 MFS_GLUT_Class1 14..458 CDD:340989 111/456 (24%)
Monosaccharide binding. /evidence=ECO:0000269|PubMed:24847886 282..288 3/5 (60%)
Disordered. /evidence=ECO:0000305|PubMed:30197081 468..492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144104
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X26
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.