DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33282 and Glut1

DIOPT Version :9

Sequence 1:NP_001097067.1 Gene:CG33282 / 2768939 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_612073.2 Gene:Glut1 / 38109 FlyBaseID:FBgn0264574 Length:1440 Species:Drosophila melanogaster


Alignment Length:489 Identity:127/489 - (25%)
Similarity:212/489 - (43%) Gaps:83/489 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YQLLATVIVNIITFGHGVGV---------GWLSPTLTKIQTADSPLDFEVNLAQISWLGSMLGLD 71
            |.:.:.|: .::.||:..||         .::..........|...:|...|..::  .|:..:.
  Fly    15 YSIFSAVL-GMLQFGYNTGVINAPEKNIENFMKDVYKDRYGEDISEEFIQQLYSVA--VSIFAIG 76

  Fly    72 SLCGNLTIAMLIERAGRKFCLYL-----MAGPYACIWILIYCASNVYYLYAARFLCGFTGGAGYL 131
            .:.|..:...:..|.|||..|.|     :||  ||:......:.:...|:..||:.|...|....
  Fly    77 GMLGGFSGGWMANRFGRKGGLLLNNVLGIAG--ACLMGFTKVSHSYEMLFLGRFIIGVNCGLNTS 139

  Fly   132 VVPIFISEVADSNIRGALTSMVMLSVDLGILAG------YILSTYLAYHVVPFLAIILPVAYFIA 190
            :||::|||:|..|:||.|.::..|:|.:|:|..      .||.|...:.::..|||...:...|.
  Fly   140 LVPMYISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILGTNEGWPILLGLAICPAILQLIL 204

  Fly   191 NIMLPETAPYLL-KKSQLAAAENSFRYYRNQRSAICEQTSKVNFEELRTAVLSQQTRNATPLSYK 254
            ..:.||:..||| .|.....|..:.|..|...|.      :.:.||:|....:||:.  :.:|..
  Fly   205 LPVCPESPRYLLITKQWEEEARKALRRLRASGSV------EEDIEEMRAEERAQQSE--SHISTM 261

  Fly   255 DLTTKPALK-GFAASIVLSLGYQFSGVFSFINYMSDIFKASGSVVD-VNTATIIIGLVQIVGVYT 317
            :|...|.|: .....||:.|..||||:.:...|.:.:|.:||...: ...|||.||.:.:|....
  Fly   262 ELICSPTLRPPLIIGIVMQLSQQFSGINAVFYYSTSLFMSSGLTEESAKFATIGIGAIMVVMTLV 326

  Fly   318 STILVDIVGRRVLMLISTMGVGIGCIAFGCF---TYLAKIYDLSDFNWLPLVLMIIICYVANIGL 379
            |..|:|..|||.|.|   .|:| |...|..|   ::|.|  ::.|  |     |..:..||.:|.
  Fly   327 SIPLMDRTGRRTLHL---YGLG-GMFIFSIFITISFLIK--EMID--W-----MSYLSVVATLGF 378

  Fly   380 IGIFF---------LVLVELFPVKIRSLATSLSVI--FLSLLVFGTLKLFPLML----HYWGISF 429
            : :||         ::..|||....|..|.:::|:  :::..|.|.  .||.|.    :|..:.|
  Fly   379 V-VFFAVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWMANFVVGI--GFPSMKTALENYTFLPF 440

  Fly   430 TMWFSAASALLTFFYFWLF----LQETKGKSMIE 459
            :::.:         .||:|    :.|||.|:..|
  Fly   441 SVFLA---------IFWIFTYKKVPETKNKTFEE 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33282NP_001097067.1 MFS 21..448 CDD:119392 120/467 (26%)
MFS_1 53..409 CDD:284993 105/383 (27%)
Glut1NP_612073.2 MFS 17..452 CDD:119392 121/472 (26%)
Sugar_tr 18..470 CDD:278511 126/486 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X26
11.000

Return to query results.
Submit another query.