DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33282 and ght6

DIOPT Version :9

Sequence 1:NP_001097067.1 Gene:CG33282 / 2768939 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_587739.1 Gene:ght6 / 2538845 PomBaseID:SPCC1235.13 Length:535 Species:Schizosaccharomyces pombe


Alignment Length:474 Identity:99/474 - (20%)
Similarity:179/474 - (37%) Gaps:128/474 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 FEVNLAQISWLGSMLGLDSLCGNLTIAMLIERAGRKFCLYLMAGPYACIWILIYCASNVYYL--- 115
            :..:.|:...|..|:...:..|.|..:.|.:|.|::.|:   .|     |.|:|....:..|   
pombe    51 YSYSSARQGLLVGMVNTGTTVGCLLSSPLGDRFGKRKCI---MG-----WTLVYITGVIVQLTTI 107

  Fly   116 ------YAARFLCGFTGGAGYLVVPIFISEVADSNIRGALTSMVMLSVDLGILAG---------Y 165
                  ..|:...|...||..::.|.:.||.:..:||||:.:...|.:.|||...         |
pombe   108 PSWVQMMVAKIWTGLGIGALSVIAPGYQSESSPPHIRGAIVTTYQLFITLGIFIAACINMGTHKY 172

  Fly   166 ILSTYLAYHVVPFLAIILPVAYFIANIMLPETAPYLLKKSQLAAAENSFRYYRNQRSAICEQTSK 230
            .......:.|...:.::..:..|...:.|||:..||..|.            ||      |:..|
pombe   173 TTHPEAQWRVPIGINLLWGILMFFGMLFLPESPRYLAVKG------------RN------EECMK 219

  Fly   231 VNFEELRTAVLSQQTRNA-----TPLSYKDLTTKPA-----LKG--------FAASI----VLSL 273
            :            .||||     .|:..|:.....|     |.|        |:..|    :|.:
pombe   220 I------------LTRNAGLPADHPIMQKEYNAIQADVEAELAGGPCSWPQIFSNEIRYRTLLGM 272

  Fly   274 G----YQFSGVFSFINYMSDIFKASGSVVDVNT---ATIIIGLVQIVGVYTSTILVDIVGRRVLM 331
            |    .|.:|...|..|.:.:|:.:|    :|:   |.:|:..|.....:.:..:::..|||..:
pombe   273 GVMAFQQLTGNNYFFYYGTQVFRGTG----LNSPFLAALILDAVNFGCTFGAIFVLEYFGRRGPL 333

  Fly   332 LISTMGVGIGCIAFGCFTYLAKIYD--LSDFNWLP-----LVLMIIICYVANIGLIGIF------ 383
            ::..:...|      ||...|.:.|  |:..|...     .|:::..|       :.||      
pombe   334 IVGGVWQSI------CFFIYASVGDRALTRPNGTSNHRAGAVMIVFSC-------LFIFSFAQTW 385

  Fly   384 ----FLVLVELFPVKIRS----LATSLSVIFLSLLVFGTLKLFPLMLHYWGISFTMWFSAASALL 440
                ::::.|.:|::.||    :||:.:..:..::.|.|    |.:.:..|..:...|:|.:...
pombe   386 APAAYVIVGESYPIRYRSKCAAVATASNWFWNFMISFFT----PFISNSIGFKYGYVFAACNLCA 446

  Fly   441 TFFYFWLFLQETKGKSMIE 459
            ....| ||.:||||.::.|
pombe   447 AIIIF-LFAKETKGLTLEE 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33282NP_001097067.1 MFS 21..448 CDD:119392 92/461 (20%)
MFS_1 53..409 CDD:284993 85/422 (20%)
ght6NP_587739.1 MFS 10..453 CDD:119392 92/461 (20%)
Sugar_tr 11..469 CDD:278511 99/474 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9279
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X26
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.