DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33282 and Slc2a1

DIOPT Version :9

Sequence 1:NP_001097067.1 Gene:CG33282 / 2768939 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster
Sequence 2:NP_620182.1 Gene:Slc2a1 / 24778 RGDID:3704 Length:492 Species:Rattus norvegicus


Alignment Length:464 Identity:112/464 - (24%)
Similarity:193/464 - (41%) Gaps:80/464 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TFGHGVGVGWLSPTLTKIQTADSPLDFEVNLAQISWLGSMLGLDSLCGNLTIAMLIERAGRK--- 89
            |:.|..|....|.|||.:        :.:::|..| :|.|:      |:.::.:.:.|.||:   
  Rat    47 TWNHRYGESIPSTTLTTL--------WSLSVAIFS-VGGMI------GSFSVGLFVNRFGRRNSM 96

  Fly    90 FCLYLMAGPYACIWILIYCASNVYYLYAARFL----CGFTGGAGYLVVPIFISEVADSNIRGALT 150
            ..:.|:|...|.:........:...|...||:    ||.|.|    .||:::.||:.:.:||||.
  Rat    97 LMMNLLAFVSAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTG----FVPMYVGEVSPTALRGALG 157

  Fly   151 SMVMLSVDLGILAGYILS------------TYLAYHVVPFL--AIILPVAYFIANIMLPETAPYL 201
            ::..|.:.:|||...:..            ..|:...:|.|  .|:||        ..||:..:|
  Rat   158 TLHQLGIVVGILIAQVFGLDSIMGNADLWPLLLSVIFIPALLQCILLP--------FCPESPRFL 214

  Fly   202 LKKSQLAAAENSFRYYRNQRSAICEQ---TSKV--NFEELRTAVLSQQTRNATPLSYKDLTTKPA 261
            |..          |...|:..::.::   |:.|  :.:|::..  .:|......::..:|...||
  Rat   215 LIN----------RNEENRAKSVLKKLRGTADVTRDLQEMKEE--GRQMMREKKVTILELFRSPA 267

  Fly   262 LK-GFAASIVLSLGYQFSGVFSFINYMSDIFKASGSVVDVNTATIIIGLVQIVGVYTSTILVDIV 325
            .: ....::||.|..|.||:.:...|.:.||:.:| |.....|||..|:|.......|..:|:..
  Rat   268 YRQPILIAVVLQLSQQLSGINAVFYYSTSIFEKAG-VQQPVYATIGSGIVNTAFTVVSLFVVERA 331

  Fly   326 GRRVLMLISTMGVGIGCIAFGCFTYLAKIYDLSDFNWLPLVLMIIICYVANIGLIGIFFLVLVEL 390
            |||.|.||...|:. ||....... ||.:..|...::|.:|.:........:|...|.:.::.||
  Rat   332 GRRTLHLIGLAGMA-GCAVLMTIA-LALLEQLPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAEL 394

  Fly   391 FPVKIRSLATSLSVI--FLSLLVFGTLKLFPLML--HYWGISFTMWFSAASALLTFFYFWLF-LQ 450
            |....|..|.:::..  :.|..:.|....:...|  .|..|.||:      .|:.||.|..| :.
  Rat   395 FSQGPRPAAVAVAGFSNWTSNFIVGMCFQYVEQLCGPYVFIIFTV------LLVLFFIFTYFKVP 453

  Fly   451 ETKGKSMIE 459
            ||||::..|
  Rat   454 ETKGRTFDE 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33282NP_001097067.1 MFS 21..448 CDD:119392 106/450 (24%)
MFS_1 53..409 CDD:284993 88/384 (23%)
Slc2a1NP_620182.1 MFS_GLUT_Class1 14..458 CDD:340989 110/458 (24%)
Monosaccharide binding. /evidence=ECO:0000250|UniProtKB:P11166 282..288 3/5 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 468..492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337863
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X26
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.