DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33281 and VBA1

DIOPT Version :9

Sequence 1:NP_995620.1 Gene:CG33281 / 2768938 FlyBaseID:FBgn0053281 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_013806.1 Gene:VBA1 / 855113 SGDID:S000004694 Length:562 Species:Saccharomyces cerevisiae


Alignment Length:116 Identity:32/116 - (27%)
Similarity:51/116 - (43%) Gaps:1/116 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 WVASNICLGGLVGTFLFTWLADRIGRKLCLMWMALPNLLGWVIIPFARTPMHLIIARFIGGAAGG 121
            |:|::..|.......|:..|:|..|||..|:.......||.::..|||......|||.|.|...|
Yeast    75 WIATSFLLTNTAFQPLYGKLSDITGRKSALLTAQFFFGLGCLLTCFARNVTEFSIARAICGIGAG 139

  Fly   122 GCFTVIPIYIAELASDNIRGILGVFLVLTCNFGLVLAFVLGYYFNYAQVSW 172
            |...:..|.::::.:...||:...:..:...||.:|...||..| ...:.|
Yeast   140 GLNAISSIAVSDICTARERGVYQGYANIVFGFGQLLGAPLGGVF-IETIGW 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33281NP_995620.1 MFS 50..452 CDD:119392 32/116 (28%)
VBA1NP_013806.1 MFS_Azr1_MDR_like 42..469 CDD:341045 32/116 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.