DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33281 and ATR1

DIOPT Version :9

Sequence 1:NP_995620.1 Gene:CG33281 / 2768938 FlyBaseID:FBgn0053281 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_013591.1 Gene:ATR1 / 854924 SGDID:S000004584 Length:542 Species:Saccharomyces cerevisiae


Alignment Length:475 Identity:94/475 - (19%)
Similarity:165/475 - (34%) Gaps:161/475 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VNIISISYGA---FCGWPSSSFLELSSENSPLDTGPLTPTDQGWVASNICLGGLVGTFLFTWLAD 78
            :||:|.|:|:   ...|..:||        ||.:|           |.|.:.|.:|        |
Yeast    93 MNILSDSFGSEGNSKSWLMASF--------PLVSG-----------SFILISGRLG--------D 130

  Fly    79 RIGRKLCLMWMALPNLLGWVII----------PFARTPMHLIIARFIGGAAGGGCFTVIPIYIAE 133
            ..|.|..|       |:|:|::          .::.:....||:|...|.   |...|:|     
Yeast   131 IYGLKKML-------LVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGL---GIAFVLP----- 180

  Fly   134 LASDNIRGILG-VFLVLTCNFGLVLAFVLGYYFNYAQVSWIVSSLSFVFVGCFWFMPETPQH--- 194
                |:.||:| :::..|....:|::||       ..::.|.::|..:|.|...  .|.|:.   
Yeast   181 ----NVLGIIGNIYVGGTFRKNIVISFV-------GAMAPIGATLGCLFAGLIG--TEDPKQWPW 232

  Fly   195 -------LAKINKIEEAEHSLRYYRNIKSNPAKELSEELQLELQKLKTTEKTTADGVDDDDAATG 252
                   .|.||.:                          |.:..:.:|..|.......|     
Yeast   233 AFYAYSIAAFINFV--------------------------LSIYAIPSTIPTNIHHFSMD----- 266

  Fly   253 VTWSDFAEGKTRKAFLIGLGLISFNQLCGCFAMLNYTAVIFEQA---GSSLPPTVAAIIVGVIQL 314
              |.....|      :|||.|::|               ::.||   |.:....:..:|:.||.|
Yeast   267 --WIGSVLG------VIGLILLNF---------------VWNQAPISGWNQAYIIVILIISVIFL 308

  Fly   315 MG------TYASTVLVERL---GRKILLLVSAVGIGLGQSAMGTYSYFQ-MLGCPVASFSWVPIA 369
            :.      .:|.|.|:.|.   .|.::.::.|:..|.|...:.|:.||| .|.....:..|   |
Yeast   309 VVFIIYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALW---A 370

  Fly   370 GFSFMLFL--AAVGLLSLPFLVVSEIMPQKIRSTAIMILMSTLWLISTCAVKLMPV----FTESL 428
            |.::.:||  ..:..|.:.|.:      :.:..:..:......:.:.:....:.||    |...|
Yeast   371 GGTYFMFLIWGIIAALLVGFTI------KNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQL 429

  Fly   429 GMHGTVFMFASLSFLAAIFI 448
            |....:.....|||.|:..|
Yeast   430 GTMIILSFGMDLSFPASSII 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33281NP_995620.1 MFS 50..452 CDD:119392 83/439 (19%)
ATR1NP_013591.1 MFS_Amf1_MDR_like 73..517 CDD:341029 94/475 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.