DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33281 and ENB1

DIOPT Version :9

Sequence 1:NP_995620.1 Gene:CG33281 / 2768938 FlyBaseID:FBgn0053281 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_014484.1 Gene:ENB1 / 854007 SGDID:S000005518 Length:606 Species:Saccharomyces cerevisiae


Alignment Length:349 Identity:72/349 - (20%)
Similarity:113/349 - (32%) Gaps:144/349 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LADRIGRKLCLMWM--------------ALPN----LLGWVIIPFARTPMHLIIARFIGGAAGGG 122
            ::||.||..|  |:              |.|.    ..|.||..|..:...|:.....|..:|..
Yeast   122 ISDRFGRIEC--WIFALVLYTIGEIISAATPTFSGLFAGIVIQQFGYSGFRLLATALTGDLSGLR 184

  Fly   123 CFT------VIPIYIAELASDNI-------------RGILGVFLVLTCNFGLVLAFVLGYYFNYA 168
            ..|      :||:.|....|.||             |...|:|.::.....|:|  ||.|.  ||
Yeast   185 DRTFAMNIFLIPVIINTWVSGNIVSSVAGNVAPYKWRWGYGIFCIIVPISTLIL--VLPYV--YA 245

  Fly   169 Q-VSWIVSSLSFVFVGCFWFMPETPQHLAKINKIEEAEHSLRYYRNIKSNPAKELSEELQLELQK 232
            | :||                                       |:.|..|.| |.|       |
Yeast   246 QYISW---------------------------------------RSGKLPPLK-LKE-------K 263

  Fly   233 LKTTEKTTADGVDDDDAATGVTWSDF-------------AEGKTRKAFLIGLGLISFNQLCGCFA 284
            .:|..:|.....||.:....:.::.|             |..|.|:..:|.:.::.     ||  
Yeast   264 GQTLRQTLWKFADDINLIGVILFTAFLVLVLLPLTIAGGATSKWREGHIIAMIVVG-----GC-- 321

  Fly   285 MLNYTAVIFEQAGSSLP---------PTVAAIIVGVIQLMGTYASTVL--VERLGRKILL--LVS 336
             |.:..:|:|...:..|         ||:             |.:.::  |.|||.:|.|  ||:
Yeast   322 -LGFIFLIWELKFAKNPFIPRVYLGDPTI-------------YVALLMEFVWRLGLQIELEYLVT 372

  Fly   337 AVGIGLGQSAMGT------YSYFQ 354
            .:.:..|:|.:..      |::.|
Yeast   373 VLMVAFGESTLSAQRIAQLYNFLQ 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33281NP_995620.1 MFS 50..452 CDD:119392 72/349 (21%)
ENB1NP_014484.1 MFS_ARN_like 63..574 CDD:340880 72/349 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.