DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33281 and GEX2

DIOPT Version :9

Sequence 1:NP_995620.1 Gene:CG33281 / 2768938 FlyBaseID:FBgn0053281 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_013032.1 Gene:GEX2 / 853981 SGDID:S000001814 Length:615 Species:Saccharomyces cerevisiae


Alignment Length:317 Identity:63/317 - (19%)
Similarity:102/317 - (32%) Gaps:116/317 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 GGLVGTFLFT-WLADRIGRKLCLMWMALPNLLGWVIIPFA---RTPMHLIIARFIGGAAGGGC-- 123
            |||....:|. |..|.:|  :.|:.::    ||.:::|..   .|......::.|.....|||  
Yeast   261 GGLFENLVFLFWKLDIVG--ILLITVS----LGCILVPLTLANETSQKWHNSKIIATLVSGGCLF 319

  Fly   124 ---------FTVIPIYIAELASDNIRGI---LGVFLVLTCNFGLVLAFVLGYYFNYAQVSWIVSS 176
                     |...|:...:|.||  |||   |||                 .:||:         
Yeast   320 FIFLYWEAKFAKSPLLPFKLLSD--RGIWAPLGV-----------------TFFNF--------- 356

  Fly   177 LSFVFVGCFWFMPETPQHLAKINKIEEAEHSLRYYRNIKSNPAKELSEELQLELQKLKTTEKTTA 241
            .:| |:.|.:..|                                    :.|...|..:|.....
Yeast   357 FTF-FISCDYLYP------------------------------------VLLVSMKESSTSAARI 384

  Fly   242 DGVDDDDAATGVTWSDFAEGKTRKAFLIGLGLISFNQLCGCFAMLNYTAVIFEQ---AGSSLPPT 303
            ..:.|..|||...:......||||..|..:|        ||.|.:....:.::.   :||.....
Yeast   385 VNLPDFVAATASPFYSLLVAKTRKLKLSVIG--------GCAAWMVCMGLFYKYRGGSGSHEGVI 441

  Fly   304 VAAIIVG------------VIQLMGTYASTVLVERLGRKILLLVSAVGIGLGQSAMG 348
            .|::|:|            ::|.|.|::...::    ..|....|.:|..:|.|..|
Yeast   442 AASVIMGLSGLLCSNSVIVILQAMTTHSRMAVI----TGIQYTFSKLGAAIGASVSG 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33281NP_995620.1 MFS 50..452 CDD:119392 63/317 (20%)
GEX2NP_013032.1 MFS_ARN_like 59..571 CDD:340880 63/317 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.