DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33281 and MPH2

DIOPT Version :9

Sequence 1:NP_995620.1 Gene:CG33281 / 2768938 FlyBaseID:FBgn0053281 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_010034.1 Gene:MPH2 / 851350 SGDID:S000002406 Length:609 Species:Saccharomyces cerevisiae


Alignment Length:511 Identity:130/511 - (25%)
Similarity:210/511 - (41%) Gaps:100/511 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 STGGDKYQYLAA----ISVNIISISY-----GAFCGWPSSSFLELSSENSPLDTGPLTPTDQGWV 58
            :|..:.|...||    :|..:|...|     |||...|... .:..|:|.  .||....:....:
Yeast    88 ATALNTYPKAAAWSLLVSTTLIMEGYDTAILGAFYALPIFQ-RKFGSQND--KTGEWEISASWQI 149

  Fly    59 ASNIC--LGGLVGTFLFTWLADRIGRKLCLMWMALPNLLGWVIIPFARTPMHLIIARFIGGAAGG 121
            ...:|  .|.:||..|.....|.:|.:..|: :||..|..:..|.:....:.:|.   :|.|..|
Yeast   150 GLTLCYMAGEIVGLQLTGPSVDLVGNRYTLI-IALFFLAAFTFILYFCNSLGMIA---VGQALCG 210

  Fly   122 ---GCFTVIPI-YIAELASDNIRGILGVFLVLTCNFGLVLA-------------FVLGYYFNYAQ 169
               |||..:.: |.:|:....:|..|..:..|...||.:.|             ..|||...:| 
Yeast   211 MPWGCFQCLTVSYASEICPLALRYYLTTYSNLCWLFGQLFAAGIMKNSQKKYADSELGYKLPFA- 274

  Fly   170 VSWIVSSLSFVFVGCFWFMPETPQHLAKINKIEEAEHSLRYYRNIK-SNPAKELSEELQLELQKL 233
            :.||:...  :.:|.| |.||:|..|.|..:.:||..|||  |.:. ..|.||:.  :.||:.|:
Yeast   275 LQWILPVP--LALGIF-FAPESPWWLVKKGRFDEARRSLR--RTLSGKGPEKEIL--VTLEVDKI 332

  Fly   234 KTT---EK--TTADGVDDDDAATGVTWSDFAEGK-----TRKAFLIGLGLISFNQLCGCFAMLNY 288
            |.|   ||  |:.:|          ::||..|.|     ||...|...|    ...||.. ::.|
Yeast   333 KVTIDKEKRLTSKEG----------SYSDCFEDKINRRRTRITCLCWAG----QATCGSI-LIGY 382

  Fly   289 TAVIFEQAGSSLPPTVAAIIVGVIQ----LMGTYASTVLVERLGRKILLLVSAVGIGLGQSAMGT 349
            :...:|:||.|   |..:....:||    :..|:.|....:..||..|.   |.|:     |..|
Yeast   383 STYFYEKAGVS---TEMSFTFSIIQYCLGICATFLSWWASKYFGRYDLY---AFGL-----AFQT 436

  Fly   350 YSYFQM--LGC------PVASFSWVPIAGFSFMLFLAAVGLLSLPFLVVSEIMPQKIRSTAIMIL 406
            ..:|.:  |||      .:.|.|.:....|.:.|     |:..:.|.:|||:...::|:..|::.
Yeast   437 IVFFIIGGLGCSSTHGSKMGSGSLLMAVAFFYNL-----GIAPVVFCLVSEMPSSRLRTKTIILA 496

  Fly   407 MSTLWLIS-TCAVKLMPVFTESLGMHG--TVFMFASLSFLAAIFIAIFVPETKGKS 459
            .:|..::| .|:|.::..........|  :.|.:..|.|...|:..:.:|||.||:
Yeast   497 RNTYNVVSIICSVLILYQLNSKKWNWGAKSGFFWGVLCFCTLIWAVVDLPETAGKT 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33281NP_995620.1 MFS 50..452 CDD:119392 110/446 (25%)
MPH2NP_010034.1 SP 72..556 CDD:273317 130/511 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342466
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.