DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33281 and AT1G05030

DIOPT Version :9

Sequence 1:NP_995620.1 Gene:CG33281 / 2768938 FlyBaseID:FBgn0053281 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_171996.2 Gene:AT1G05030 / 839340 AraportID:AT1G05030 Length:524 Species:Arabidopsis thaliana


Alignment Length:471 Identity:111/471 - (23%)
Similarity:207/471 - (43%) Gaps:56/471 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VNIISIS---YGAFCGWPSSSFLELSSE-----NSPLDTGPLTPTDQGWVASNICLGGLVGTFLF 73
            |::.|::   :|...|..:...:.::.|     ||.|         :|.|.|....|..:|:.:.
plant    83 VSVASMANFLFGYHIGVMNGPIVSIARELGFEGNSIL---------EGLVVSIFIAGAFIGSIVA 138

  Fly    74 TWLADRIGRKLCLMWMALPNLLGWVIIPFARTPMHLIIARFIGGAAGGGCFTVIPIYIAELASDN 138
            ..|.|:.|.:.......:|.:||.::...|.:...::..||:.|...|....::||||:|:|...
plant   139 GPLVDKFGYRRTFQIFTIPLILGALVSAQAHSLDEILCGRFLVGLGIGVNTVLVPIYISEVAPTK 203

  Fly   139 IRGILGVFLVLTCNFGLVLAFVLGYYFN-----YAQVSWIVSSLSFVFVGCFWFMPETPQHLAKI 198
            .||.||....:....|::.:.:||....     :..:.::.|...|:......|..|:|:.|.|:
plant   204 YRGSLGTLCQIGTCLGIIFSLLLGIPAEDDPHWWRTMLYVASMPGFLLALGMQFAVESPRWLCKV 268

  Fly   199 NKIEEAEHSLRYYRNIKSNPAKELSEELQLELQKLKTTEKTTADGVDDDDAATGVTWSDFAEGKT 263
            .::::|:..:   |||..      ..|::..::..::..|.:...::.       .|.:..:...
plant   269 GRLDDAKVVI---RNIWG------GSEVEKAVEDFQSVMKNSGSNLNS-------RWLELLDKPH 317

  Fly   264 RKAFLIGLGLISFNQLCGCFAMLNYTAVIFEQAGSSLPPTVAAIIVGVIQLMGTYASTVLVERLG 328
            .:...||..|....|..|...:|.::::.|:..|.: ....|::.|||....|...::.|:::.|
plant   318 SRVAFIGGSLFVLQQFAGINGVLYFSSLTFQNVGIT-SGAQASLYVGVTNFAGALCASYLIDKQG 381

  Fly   329 RKILLLVSAVGIGLGQSAMGTYSYFQMLGCPV-----ASFSWVPIAGFSFMLFLAAVGLLSLPFL 388
            ||.||:.|.:|:     |:..:.....:|.|:     .|.|   |.|....:|..|:|...:..|
plant   382 RKKLLIGSYLGM-----AVSMFLIVYAVGFPLDEDLSQSLS---ILGTLMYIFSFAIGAGPVTGL 438

  Fly   389 VVSEIMPQKIRSTAIMILMSTLWLISTCAVKLMPV-FTESLGMHGTVF-MFASLSFLAAIFIAIF 451
            ::.|:...:.|...:....|..| :|...|.|..: ..|..|: |||: .|.|:|.|||.|..:|
plant   439 IIPELSSNRTRGKIMGFSFSVHW-VSNFLVGLFFLDLVEKYGV-GTVYASFGSVSLLAAAFSHLF 501

  Fly   452 VPETKGKSVDAILASL 467
            ..||||:|::.|..||
plant   502 TVETKGRSLEEIELSL 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33281NP_995620.1 MFS 50..452 CDD:119392 94/413 (23%)
AT1G05030NP_171996.2 MFS_GLUT_like 85..504 CDD:340873 102/454 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X26
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.