DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33281 and SFP1

DIOPT Version :9

Sequence 1:NP_995620.1 Gene:CG33281 / 2768938 FlyBaseID:FBgn0053281 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_568493.1 Gene:SFP1 / 832794 AraportID:AT5G27350 Length:474 Species:Arabidopsis thaliana


Alignment Length:468 Identity:137/468 - (29%)
Similarity:229/468 - (48%) Gaps:45/468 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ISVNIISISYGAFCGWPSSSFLELSSENSPLDTGPLTPTDQGWV-----ASNICLGGLVGTFLFT 74
            |:..:|..::.|.||  |.||...:...|..:||.:...|....     .|...||..:|.....
plant    27 ITACVILSTFVAVCG--SFSFGVATGYTSGAETGVMKDLDLSIAQFSAFGSFATLGAAIGALFCG 89

  Fly    75 WLADRIGRKLCLMWMA-LPNLLGWVIIPFARTPMHLIIARFIGGAAGGGCFTVIPIYIAELASDN 138
            .||..|||: ..||:: ...:.||:.|.||:..:.|...|.|.|...|....|:|:||||:...:
plant    90 NLAMVIGRR-GTMWVSDFLCITGWLSIAFAKEVVLLNFGRIISGIGFGLTSYVVPVYIAEITPKH 153

  Fly   139 IRGILGVFLVLTCNFGLVLAFVLGYYFNYAQVSWIVSSLSFVFVGCFWFMPETPQHLAKINKIEE 203
            :||.......|..|.||.:.:..|.:..:..::.:.:...|:.|...:|:||:|:.|||:...:|
plant   154 VRGTFTFSNQLLQNAGLAMIYFCGNFITWRTLALLGALPCFIQVIGLFFVPESPRWLAKVGSDKE 218

  Fly   204 AEHSLRYYRNIKSNPAKELSEELQLELQKLKTTEKTTADGVDDDDAATGVTWSDFAEGKTRKAFL 268
            .|:||...|...::.::|.| |:|:..:.::...|:              ::||..:.|.|...:
plant   219 LENSLFRLRGRDADISREAS-EIQVMTKMVENDSKS--------------SFSDLFQRKYRYTLV 268

  Fly   269 IGLGLISFNQLCGCFAMLNYTAVIFEQAGSSLPPTVAAIIVGVIQLMGTYASTVLVERLGRKILL 333
            :|:||:...|..|..|:::|.:.||.:||.|:  .:...::|:..:.......:||::.||:.||
plant   269 VGIGLMLIQQFSGSAAVISYASTIFRKAGFSV--AIGTTMLGIFVIPKAMIGLILVDKWGRRPLL 331

  Fly   334 LVSAVGIGLGQSAMG---TYSYFQMLG--CPVASFSWVPIAGFSFMLFLA--AVGLLSLPFLVVS 391
            :.||.|:.:....:|   |....|:|.  .|:.||..|       |:::|  |:||..||::::|
plant   332 MTSAFGMSMTCMLLGVAFTLQKMQLLSELTPILSFICV-------MMYIATYAIGLGGLPWVIMS 389

  Fly   392 EIMPQKIRSTA--IMILMSTLWLISTCAVKLMPVFTESLGMHGTVFMFASLSFLAAIFIAIFVPE 454
            ||.|..|:.||  |:.|:|   ..|:..|.....|.......||.|:||.:...|.:||.:.|||
plant   390 EIFPINIKVTAGSIVTLVS---FSSSSIVTYAFNFLFEWSTQGTFFIFAGIGGAALLFIWLLVPE 451

  Fly   455 TKGKSVDAILASL 467
            |||.|::.|..||
plant   452 TKGLSLEEIQVSL 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33281NP_995620.1 MFS 50..452 CDD:119392 116/416 (28%)
SFP1NP_568493.1 Sugar_tr 35..462 CDD:278511 133/456 (29%)
MFS 35..449 CDD:119392 125/443 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53651
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48021
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X26
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.