DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33281 and PGLCT

DIOPT Version :9

Sequence 1:NP_995620.1 Gene:CG33281 / 2768938 FlyBaseID:FBgn0053281 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_568328.1 Gene:PGLCT / 831472 AraportID:AT5G16150 Length:546 Species:Arabidopsis thaliana


Alignment Length:452 Identity:126/452 - (27%)
Similarity:204/452 - (45%) Gaps:73/452 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SENSPLDTGPLTPTDQGWVASNICLGGLVGTFLFTWLADRIGRKLCLMWMALPNLLGWVIIPFAR 104
            :||:.|         |||:.|::..|..||:|....|||:.||.......|:|..:|..:...|:
plant   140 AENTVL---------QGWIVSSLLAGATVGSFTGGALADKFGRTRTFQLDAIPLAIGAFLCATAQ 195

  Fly   105 TPMHLIIARFIGGAAGGGCFTVIPIYIAELASDNIRGILGVFLVLTCNFGLVLAFVLGY------ 163
            :...:|:.|.:.|...|....::|:||:|::...|||.||....|....|::.|.:.|.      
plant   196 SVQTMIVGRLLAGIGIGISSAIVPLYISEISPTEIRGALGSVNQLFICIGILAALIAGLPLAANP 260

  Fly   164 -----YFNYAQVSWIVSSLSFVFVGCFWFMPETPQHLAKINKIEEAEHSLRYYRNIKSNPAKELS 223
                 .|..|.:..::.::...      |.||:|:.|.:..|:.|||      :.||:...||..
plant   261 LWWRTMFGVAVIPSVLLAIGMA------FSPESPRWLVQQGKVSEAE------KAIKTLYGKERV 313

  Fly   224 EELQLELQKLKTTEKTTADGVDDDDAATGVTWSDFAEGKTRKAFLIGLGLISFNQLCGCFAMLNY 288
            .||..:|         :|.|....:...|  |.|....:..|...:|..|..|.||.|..|::.|
plant   314 VELVRDL---------SASGQGSSEPEAG--WFDLFSSRYWKVVSVGAALFLFQQLAGINAVVYY 367

  Fly   289 TAVIFEQAGSSLPPTVAAIIVGVIQLMGTYASTVLVERLGRKILLLVSAVGIGLGQSAMGTYSYF 353
            :..:|..||.. ....|:.:||...:.||..::.|::::|||.|||.|..|:.|....:.     
plant   368 STSVFRSAGIQ-SDVAASALVGASNVFGTAVASSLMDKMGRKSLLLTSFGGMALSMLLLS----- 426

  Fly   354 QMLGCPVASFSWVPIAGFSFMLFLAAVG----LLS-------LPFLVVSEIMPQKIRSTAIMILM 407
                   .||:|..:|.:|..  ||.||    :||       :|.|::.||...:||:.|:.:.:
plant   427 -------LSFTWKALAAYSGT--LAVVGTVLYVLSFSLGAGPVPALLLPEIFASRIRAKAVALSL 482

  Fly   408 STLWLISTCAVKL--MPVFTESLGMHGTVFMFASLSFLAAIFIAIFVPETKGKSVDAILASL 467
            ...| ||...:.|  :.|.|: .|:......||.:..||.::||..|.||||:|::.|..:|
plant   483 GMHW-ISNFVIGLYFLSVVTK-FGISSVYLGFAGVCVLAVLYIAGNVVETKGRSLEEIELAL 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33281NP_995620.1 MFS 50..452 CDD:119392 115/425 (27%)
PGLCTNP_568328.1 MFS 109..524 CDD:119392 116/432 (27%)
Sugar_tr 111..539 CDD:278511 124/447 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53651
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X26
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.