DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33281 and SLC2A4

DIOPT Version :9

Sequence 1:NP_995620.1 Gene:CG33281 / 2768938 FlyBaseID:FBgn0053281 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_001033.1 Gene:SLC2A4 / 6517 HGNCID:11009 Length:509 Species:Homo sapiens


Alignment Length:450 Identity:120/450 - (26%)
Similarity:194/450 - (43%) Gaps:63/450 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SPLDTGPLTPTDQGWVAS--NICLGGLVGTFLFTWLADRIGRKLCLMWMALPNLLGWVIIPFART 105
            |.:..|.||..   |..|  ...:||::.:||...::..:|||..::...:..:||..::..|..
Human    70 SSIPPGTLTTL---WALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAVLGGSLMGLANA 131

  Fly   106 PMH---LIIARFIGGAAGGGCFTVIPIYIAELASDNIRGILGVFLVLTCNFGLVLAFVLGYYFNY 167
            ...   ||:.||:.||..|....::|:|:.|:|..::||.||....|....|:::|.|||.....
Human   132 AASYEMLILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAIVIGILIAQVLGLESLL 196

  Fly   168 AQVS-W--------IVSSLSFVFVGCFWFMPETPQHLAKINKIE-EAEHSLR----------YYR 212
            ...| |        :.:.|..|.:.   |.||:|::|..|..:| .|..||:          ...
Human   197 GTASLWPLLLGLTVLPALLQLVLLP---FCPESPRYLYIIQNLEGPARKSLKRLTGWADVSGVLA 258

  Fly   213 NIKSNPAKELSEELQLELQKLKTTEKTTADGVDDDDAATGVTWSDFAEGKTRKAFLIGLGLISFN 277
            .:|....| |..|..|.|.:|                        ......|:..:|.:.|....
Human   259 ELKDEKRK-LERERPLSLLQL------------------------LGSRTHRQPLIIAVVLQLSQ 298

  Fly   278 QLCGCFAMLNYTAVIFEQAGSSLPPTVAAIIVGVIQLMGTYASTVLVERLGRKILLLVSAVGIGL 342
            ||.|..|:..|:..|||.||.. .|..|.|..||:..:.|..|.:||||.||:.|.|:...|: .
Human   299 QLSGINAVFYYSTSIFETAGVG-QPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGM-C 361

  Fly   343 GQSAMGTYSYFQMLGCPVASFSWVPIAGFSFMLFLAAVGLLSLPFLVVSEIMPQKIRSTAIMILM 407
            |.:.:.|.:...:...|..|:..: :|.|.|:.|. .:|...:|:.:|:|:..|..|..|:.:..
Human   362 GCAILMTVALLLLERVPAMSYVSI-VAIFGFVAFF-EIGPGPIPWFIVAELFSQGPRPAAMAVAG 424

  Fly   408 STLWLISTCAVKLMPVFTESLGMHGTVF-MFASLSFLAAIFIAIFVPETKGKSVDAILAS 466
            .:.|..:...........|::|.:  || :||.|.....||..:.||||:|::.|.|.|:
Human   425 FSNWTSNFIIGMGFQYVAEAMGPY--VFLLFAVLLLGFFIFTFLRVPETRGRTFDQISAA 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33281NP_995620.1 MFS 50..452 CDD:119392 110/427 (26%)
SLC2A4NP_001033.1 Interaction with SRFBP1. /evidence=ECO:0000269|PubMed:16647043 7..13
Sugar_tr 27..483 CDD:306568 120/449 (27%)
Monosaccharide binding. /evidence=ECO:0000250|UniProtKB:P11166 298..304 3/5 (60%)
Dileucine internalization motif. /evidence=ECO:0000269|PubMed:8300557 489..490
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144114
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X26
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.