DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33281 and sut3

DIOPT Version :9

Sequence 1:NP_995620.1 Gene:CG33281 / 2768938 FlyBaseID:FBgn0053281 Length:467 Species:Drosophila melanogaster
Sequence 2:NP_524731.1 Gene:sut3 / 44268 FlyBaseID:FBgn0028561 Length:476 Species:Drosophila melanogaster


Alignment Length:494 Identity:119/494 - (24%)
Similarity:190/494 - (38%) Gaps:113/494 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IISISY--------GAFC-GWPSSSFLELSSENSPLDTGPLTPTDQGWVASNICLGGLVGTFLFT 74
            :|.:.|        .||. .|...|.||..|  |.|....:| .....|.|...:||::|.....
  Fly    24 VIPVGYAFGVMNAPSAFIRSWIMESVLERYS--SRLGDSQMT-IIMSTVVSIFLIGGMLGAPFAP 85

  Fly    75 WLADRIGRKLCLMWMALPNLLGWVIIPFARTPMH---LIIARFIGGAAGGGCFTVIPIYIAELAS 136
            ..:.|:||:..|....|..|:..:...|.|....   |::.|.|||.|....:...|:|:.|||.
  Fly    86 IFSARLGRRGILTLSGLLLLVSCICQLFCRMANSIEMLLLGRLIGGLAAALIYATQPMYLVELAP 150

  Fly   137 DNIRGILGVFLVLTCNFGLVLAFVLGYYFNY-----AQVSW---IVSSLSFVFVG---CFWFMPE 190
            ..:.|.:|||   || .||....|||..|::     .:..|   :..|..||.:|   .||| ||
  Fly   151 AELSGSVGVF---TC-IGLTGGIVLGQVFSFDFLLGTEKLWPYALSGSAIFVLIGLAPIFWF-PE 210

  Fly   191 TPQHLAKINKIEEAEHSLRYYRNIKSNPAKELSEELQLELQKLKTTEKTTADGVDDDDAATGVTW 255
            :|:.|....:.|:|..:|...|..:.....|::|           .|.::.|             
  Fly   211 SPRFLMSQGRREKARVTLMRLRRDEGRVNAEMAE-----------FEVSSTD------------- 251

  Fly   256 SDFAEGK-TRKAFLIGLGL-------ISFN---QLCGCFAMLNYTAVIFEQAGSSLPPTVAAI-- 307
                ||: |.|..|....|       .||:   |:.|..|:..|:..||.|:|.:     ||:  
  Fly   252 ----EGQVTMKQVLCNSKLKLPLFIVCSFHFVQQMSGISAIWFYSIEIFTQSGFT-----AAVAM 307

  Fly   308 ----IVGVIQLMGTYASTVLVERLGRKILLLVSA-------VGIGLGQSAMGTYSYFQMLGCPVA 361
                .:|::..:.......|:....|::::.:|.       |.:.:|...|.|          :.
  Fly   308 WLNFALGLLNFISALMGPWLMRSFNRRLMMTISCLCSAIFLVLLVVGLELMST----------IH 362

  Fly   362 SFSWVPIAGFSFMLFLAAVGLLSLPFLVVSEIMPQKIRSTAIMILMSTLWLISTCAVKLMPVFTE 426
            .||:..||..|..:....:||...|:.:.|||.....|.:|:.:.....||.:.....:.|....
  Fly   363 EFSFTCIAFLSLYIITFNMGLGPTPYFIGSEIFETASRPSAMALGSFFNWLANFVLNMIFPTLNS 427

  Fly   427 SLGMHGTVFMFASLSFLAAIFIAI-------FVPETKGK 458
            :.|    .|:|    .|..:|.|.       ::|||:.:
  Fly   428 ATG----PFVF----LLCVVFCAYGFLLTYRYLPETRNR 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33281NP_995620.1 MFS 50..452 CDD:119392 105/446 (24%)
sut3NP_524731.1 Sugar_tr 28..466 CDD:278511 118/490 (24%)
MFS 66..451 CDD:119392 104/440 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444463
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.